Cell death activator CIDE-3 (CIDEC) Recombinant Protein | CIDEC recombinant protein

Recombinant Human Cell death activator CIDE-3 (CIDEC)

Cat. Num. AAA1420914

• Gene Names: CIDEC; CIDE3; FPLD5; FSP27; CIDE-3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cell death activator CIDE-3 (CIDEC); Recombinant Human Cell death activator CIDE-3 (CIDEC); Cell death activator CIDE-3; Cell death-inducing DFFA-like effector protein C; Fat-specific protein FSP27 homolog; CIDEC recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-238aa; Full Length
• Sequence: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
• Sequence Length: 238

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for CIDEC recombinant protein

Binds to lipid droplets and regulates their enlargement, thereby restricting lipolysis and favoring storage. At focal contact sites between lipid droplets, promotes directional net neutral lipid transfer from the smaller to larger lipid droplets. The transfer direction may be driven by the internal pressure difference between the contacting lipid droplet pair. Its role in neutral lipid transfer and lipid droplet enlargement is activated by the interaction with PLIN1. May act as a CEBPB coactivator in the white adipose tissue to control the expression of a subset of CEBPB downstream target genes, including SOCS1, SOCS3, TGFB1, TGFBR1, ID2 and XDH. When overexpressed in preadipocytes, induces apoptosis or increases cell susceptibility to apoptosis induced by serum deprivation or TGFB treatment. As mature adipocytes, that express high CIDEC levels, are quite resistant to apoptotic stimuli, the physiological significance of its role in apoptosis is unclear. May play a role in the modulation of the response to osmotic stress by preventing NFAT5 to translocate into the nucleus and activate its target genes expression.

Product Categories/Family for CIDEC recombinant protein

Cell Biology

NCBI and Uniprot Product Information

• NCBI GI #: 313851088
• NCBI GeneID: 63924
• NCBI Accession #: NP_001186480.1
• NCBI GenBank Nucleotide #: NM_001199551.1
• UniProt Accession #: Q96AQ7; Q67DW9; Q9GZY9; C9JMN7
• Molecular Weight: 53.8 kDa
• NCBI Official Full Name: cell death activator CIDE-3 isoform 2
• NCBI Official Synonym Full Names: cell death-inducing DFFA-like effector c
• NCBI Official Symbol: CIDEC
• NCBI Official Synonym Symbols: CIDE3; FPLD5; FSP27; CIDE-3
• NCBI Protein Information: cell death activator CIDE-3; fat specific protein 27
• UniProt Protein Name: Cell death activator CIDE-3
• Protein Family: Cell death activator
• UniProt Gene Name: CIDEC
• UniProt Synonym Gene Names: FSP27
• UniProt Entry Name: CIDEC_HUMAN

NCBI Description

This gene encodes a member of the cell death-inducing DNA fragmentation factor-like effector family. Members of this family play important roles in apoptosis. The encoded protein promotes lipid droplet formation in adipocytes and may mediate adipocyte apoptosis. This gene is regulated by insulin and its expression is positively correlated with insulin sensitivity. Mutations in this gene may contribute to insulin resistant diabetes. A pseudogene of this gene is located on the short arm of chromosome 3. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

CIDEC: May act as a CEBPB coactivator in white adipose tissue to control the expression of a subset of CEBPB downstream target genes, including SOCS1, SOCS3, TGFB1, TGFBR1, ID2 and XDH. Binds to lipid droplets and regulates their enlargement, thereby restricting lipolysis and favoring storage. At focal contact sites between lipid droplets, promotes directional net neutral lipid transfer from the smaller to larger lipid droplets. The transfer direction may be driven by the internal pressure difference between the contacting lipid droplet pair. When overexpressed in preadipocytes, induces apoptosis or increases cell susceptibility to apoptosis induced by serum deprivation or TGFB treatment. As mature adipocytes, that express high CIDEC levels, are quite resistant to apoptotic stimuli, the physiological significance of its role in apoptosis is unclear. In omental adipose tissue of obese patients matched for BMI, expression levels tend to correlate with insulin sensitivity. Expression is increased 2-3 fold in the group of patients with high insulin sensitivity, compared to the insulin- resistant group. This observation is consistent with the idea that triglyceride storage in adipocytes plays an important role in sequestering triglycerides and fatty acids away from the circulation and peripheral tissues, thus enhancing insulin sensitivity in liver and muscle. This effect is not significant in subcutaneous adipose tissue (PubMed:18509062). In subcutaneous adipose tissue of diabetic patients, tends to negatively correlate with body mass index and total fat mass, independently of insulin sensitivity (PubMed:18334488). 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: endoplasmic reticulum; lipid particle; nucleus; cytosol

Biological Process: regulation of apoptosis; regulation of transcription, DNA-dependent; transcription, DNA-dependent; apoptosis

Disease: Lipodystrophy, Familial Partial, Type 5