Cell death activator CIDE-A (Cidea) Recombinant Protein | Cidea recombinant protein

Recombinant Mouse Cell death activator CIDE-A (Cidea)

Cat. Num. AAA1253932

• Gene Names: Cidea; AW212747
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cell death activator CIDE-A (Cidea); Recombinant Mouse Cell death activator CIDE-A (Cidea); Cidea recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-217, Full length protein
• Sequence: METARDYAGALIRPLTFMGLQTKKVLLTPLIHPARPFRVSNHDRSSRRGVMASSLQELISKTLDVLVITTGLVTLVLEEDGTVVDTEEFFQTLRDNTHFMILEKGQKWTPGSKYVPVCKQPKKSGIARVTFDLYRLNPKDFLGCLNVKATMYEMYSVSYDIRCTSFKAVLRNLLRFMSYAAQMTGQFLVYAGTYMLRVLGDTEEQPSPKPSTKGWFM
• Sequence Length: 217

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Cidea recombinant protein

This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Two alternative transcripts encoding different isoforms have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 162287227
• NCBI GeneID: 12683
• NCBI Accession #: NP_031728.2
• NCBI GenBank Nucleotide #: NM_007702.2
• UniProt Accession #: O70302; Q4V9X2
• Molecular Weight: 24,669 Da
• NCBI Official Full Name: cell death activator CIDE-A
• NCBI Official Synonym Full Names: cell death-inducing DNA fragmentation factor, alpha subunit-like effector A
• NCBI Official Symbol: Cidea
• NCBI Official Synonym Symbols: AW212747
• NCBI Protein Information: cell death activator CIDE-A
• UniProt Protein Name: Cell death activator CIDE-A
• Protein Family: Cell death activator
• UniProt Gene Name: Cidea

Uniprot Description

Binds to lipid droplets and regulates their enlargement, thereby restricting lipolysis and favoring storage. At focal contact sites between lipid droplets, promotes directional net neutral lipid transfer from the smaller to larger lipid droplets. The transfer direction may be driven by the internal pressure difference between the contacting lipid droplet pair and occurs at a lower rate than that promoted by CIDEC. Acts as a CEBPB coactivator in mammary epithelial cells to control the expression of a subset of CEBPB downstream target genes, including ID2, IGF1, PRLR, SOCS1, SOCS3, XDH, but not casein. By interacting with CEBPB, strengthens the association of CEBPB with the XDH promoter, increases histone acetylation and dissociates HDAC1 from the promoter. When overexpressed, induces apoptosis. The physiological significance of its role in apoptosis is unclear.