Rabbit anti-Human CIDEA Polyclonal Antibody | anti-CIDEA antibody

CIDEA Antibody - middle region

Cat. Num. AAA3221605

• Gene Names: CIDEA; CIDE-A
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: CIDEA; Polyclonal Antibody; CIDEA Antibody - middle region; anti-CIDEA antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGT
• Sequence Length: 219

• Applicable Applications for anti-CIDEA antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CIDEA
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CIDEASample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-CIDEA antibody

This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Alternatively spliced transcripts have been identified.

Product Categories/Family for anti-CIDEA antibody

Polyclonal; Apoptosis; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 4557465
• NCBI GeneID: 1149
• NCBI Accession #: NP_001270.1
• NCBI GenBank Nucleotide #: NM_001279.3
• UniProt Accession #: O60543
• Molecular Weight: 24 kDa
• NCBI Official Full Name: cell death activator CIDE-A isoform 1
• NCBI Official Synonym Full Names: cell death inducing DFFA like effector a
• NCBI Official Symbol: CIDEA
• NCBI Official Synonym Symbols: CIDE-A
• NCBI Protein Information: cell death activator CIDE-A
• UniProt Protein Name: Cell death activator CIDE-A
• Protein Family: Cell death activator
• UniProt Gene Name: CIDEA
• UniProt Entry Name: CIDEA_HUMAN

NCBI Description

This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Alternatively spliced transcripts have been identified. [provided by RefSeq, Aug 2010]

Uniprot Description

CIDEA: Acts as a CEBPB coactivator in mammary epithelial cells to control the expression of a subset of CEBPB downstream target genes, including ID2, IGF1, PRLR, SOCS1, SOCS3, XDH, but not casein. By interacting with CEBPB, strengthens the association of CEBPB with the XDH promoter, increases histone acetylation and dissociates HDAC1 from the promoter. Binds to lipid droplets and regulates their enlargement, thereby restricting lipolysis and favoring storage. At focal contact sites between lipid droplets, promotes directional net neutral lipid transfer from the smaller to larger lipid droplets. The transfer direction may be driven by the internal pressure difference between the contacting lipid droplet pair and occurs at a lower rate than that promoted by CIDEC. When overexpressed, induces apoptosis. The physiological significance of its role in apoptosis is unclear. In omental and subcutaneous adipose tissue of obese patients matched for BMI, expression levels correlate with insulin sensitivity. Expression is increased 5-6 fold in the group of patients with high insulin sensitivity, compared to the insulin- resistant group. This observation is consistent with the idea that triglyceride storage in adipocytes plays an important role in sequestering triglycerides and fatty acids away from the circulation and peripheral tissues, thus enhancing insulin sensitivity in liver and muscle.

Protein type: Apoptosis; Mitochondrial

Chromosomal Location of Human Ortholog: 18p11.21|18

Cellular Component: mitochondrial envelope; mitochondrion; cytoplasm; lipid particle; nucleus

Molecular Function: protein homodimerization activity

Biological Process: cell death; regulation of apoptosis; sequestering of lipid; regulation of transcription, DNA-dependent; transcription, DNA-dependent; negative regulation of lipid catabolic process; apoptosis; negative regulation of cytokine secretion; lipid metabolic process; negative regulation of tumor necrosis factor production; thermoregulation; negative regulation of transforming growth factor beta receptor signaling pathway