Uncharacterized protein C1orf51 homolog (Gm129) Recombinant Protein | Gm129 recombinant protein
Recombinant Mouse Uncharacterized protein C1orf51 homolog (Gm129)
Gene Names
Ciart; Gm129; Chrono
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein C1orf51 homolog (Gm129); Recombinant Mouse Uncharacterized protein C1orf51 homolog (Gm129); Gm129 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-375, full length protein
Sequence
MDSPSSVSSYSSSSLSPSFSTSSVNSDFSFPSDNEREGKGTHELRPDTVGQRGGSRPSPGPIRCRHRPRVSSNQHTAPHLEQQGSEVKRSRDGEQETSLNTQGCTTEGDLLFAQKCKELQGFIRPLTDLLNGLKMGRFDRGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPHIAAQKSSSGGSRHQISKHFPSHHGDPGAASPAPLLEKMGQTQLGHLVLKPKQPWHLTGWPAMNLTWIHSTPICNPPLSSQGSASGHSPIGTGASIGVILVLQKGGQPFTHSAPGTPVPPTPLSPVVPGDLKKLPGEEPRCHSLPVTLPSDWSCILCPPVLPTTDREMTKGHPEPQMTSHPPVAPDPQP
Sequence Length
375
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,408 Da
NCBI Official Full Name
circadian-associated transcriptional repressor
NCBI Official Synonym Full Names
circadian associated repressor of transcription
NCBI Official Symbol
Ciart
NCBI Official Synonym Symbols
Gm129; Chrono
NCBI Protein Information
circadian-associated transcriptional repressor
UniProt Protein Name
Circadian-associated transcriptional repressor
UniProt Gene Name
Ciart
UniProt Synonym Gene Names
Gm129; Chrono
Uniprot Description
Transcriptional repressor which forms a negative regulatory component of the circadian clock and acts independently of the circadian transcriptional repressors: CRY1, CRY2 and BHLHE41. In a histone deacetylase-dependent manner represses the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Abrogates the interaction of ARNTL/BMAL1 with the transcriptional coactivator CREBBP and can repress the histone acetyl-transferase activity of the CLOCK-ARNTL/BMAL1 heterodimer, reducing histone acetylation of its target genes. Rhythmically binds the E-box elements (5'-CACGTG-3') on circadian gene promoters and its occupancy shows circadian oscillation antiphasic to ARNTL/BMAL1. Interacts with the glucocorticoid receptor (NR3C1) and contributes to the repressive function in the glucocorticoid response.
Research Articles on Gm129
Similar Products
Product Notes
The Gm129 ciart (Catalog #AAA1387301) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-375, full length protein. The amino acid sequence is listed below: MDSPSSVSSY SSSSLSPSFS TSSVNSDFSF PSDNEREGKG THELRPDTVG QRGGSRPSPG PIRCRHRPRV SSNQHTAPHL EQQGSEVKRS RDGEQETSLN TQGCTTEGDL LFAQKCKELQ GFIRPLTDLL NGLKMGRFDR GLSSFQQSVA MDRIQRIVGV LQKPQMGERY LGTLLQVEGM LKTWFPHIAA QKSSSGGSRH QISKHFPSHH GDPGAASPAP LLEKMGQTQL GHLVLKPKQP WHLTGWPAMN LTWIHSTPIC NPPLSSQGSA SGHSPIGTGA SIGVILVLQK GGQPFTHSAP GTPVPPTPLS PVVPGDLKKL PGEEPRCHSL PVTLPSDWSC ILCPPVLPTT DREMTKGHPE PQMTSHPPVA PDPQP. It is sometimes possible for the material contained within the vial of "Uncharacterized protein C1orf51 homolog (Gm129), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
