Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5) Recombinant Protein | CHRNA5 recombinant protein

Recombinant Human Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5)

Gene Names
CHRNA5; LNCR2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5); Recombinant Human Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5); CHRNA5 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-468aa; Full length protein
Sequence
RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQ LVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGR FEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIIL EDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCI GLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMI FVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTLPKLLCMRSHVDRYFTQKEETES GSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDWKFIAQVLDRMFLWTFLFVSIVG SLGLFVPVIYKWANILIPVHIGNANK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CHRNA5 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,054 Da
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-5 isoform 1
NCBI Official Synonym Full Names
cholinergic receptor nicotinic alpha 5 subunit
NCBI Official Symbol
CHRNA5
NCBI Official Synonym Symbols
LNCR2
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-5
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-5
UniProt Gene Name
CHRNA5
UniProt Synonym Gene Names
NACHRA5
UniProt Entry Name
ACHA5_HUMAN

NCBI Description

The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).[provided by RefSeq, Jun 2010]

Uniprot Description

nAChRA5: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha- 5/CHRNA5 sub-subfamily.

Protein type: Channel, ligand-gated; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 15q24

Cellular Component: cell junction; cell soma; dendrite; nicotinic acetylcholine-gated receptor-channel complex; plasma membrane; postsynaptic membrane

Molecular Function: acetylcholine binding; acetylcholine receptor activity; ligand-gated ion channel activity; nicotinic acetylcholine-activated cation-selective channel activity; protein binding; protein heterodimerization activity

Biological Process: behavioral response to nicotine; neuromuscular synaptic transmission; signal transduction; synaptic transmission; synaptic transmission, cholinergic; transport

Disease: Smoking As A Quantitative Trait Locus 3

Research Articles on CHRNA5

Similar Products

Product Notes

The CHRNA5 chrna5 (Catalog #AAA7011451) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-468aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CHRNA5 chrna5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RCGLAGAAGG AQRGLSEPSS IAKHEDSLLK DLFQDYERWV RPVEHLNDKI KIKFGLAISQ LVDVDEKNQL MTTNVWLKQE WIDVKLRWNP DDYGGIKVIR VPSDSVWTPD IVLFDNADGR FEGTSTKTVI RYNGTVTWTP PANYKSSCTI DVTFFPFDLQ NCSMKFGSWT YDGSQVDIIL EDQDVDKRDF FDNGEWEIVS ATGSKGNRTD SCCWYPYVTY SFVIKRLPLF YTLFLIIPCI GLSFLTVLVF YLPSNEGEKI CLCTSVLVSL TVFLLVIEEI IPSSSKVIPL IGEYLVFTMI FVTLSIMVTV FAINIHHRSS STHNAMAPLV RKIFLHTLPK LLCMRSHVDR YFTQKEETES GSGPKSSRNT LEAALDSIRY ITRHIMKEND VREVVEDWKF IAQVLDRMFL WTFLFVSIVG SLGLFVPVIY KWANILIPVH IGNANK. It is sometimes possible for the material contained within the vial of "Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.