Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

CD86 protein

CD86(P2)-muIg-Purified Preservative Free

Gene Names
CD86; B70; B7-2; B7.2; LAB72; CD28LG2
Reactivity
Human
Applications
Flow Cytometry, Functional Assay, ELISA
Purity
Purified Preservative Free
Synonyms
CD86; CD86(P2)-muIg-Purified Preservative Free; Human CD86(p2)-muIg Fusion Protein; CD86 protein
Ordering
For Research Use Only!
Host
CHO cells
Reactivity
Human
Purity/Purification
Purified Preservative Free
Form/Format
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl
Concentration
0.5 mg/ml (varies by lot)
Sequence Length
323
Applicable Applications for CD86 protein
Flow Cytometry (FC/FACS), ELISA (EIA)
Molecular Structure
A soluble fusion protein consisting of the extracellular (224 aa) domain of human CD86 fused to murine IgG2a Fc region. This molecules contains 1 amino acid polymorphism when compared to Genebank sequence HUMB72A: v(162)i, This residue has not been implicated in the CD86-CD152 binding site(5). CD86 EC (224 aa): (1)aplkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymgrtsfdsdswtlrlhnlqikdkglyqcii(90)rhkkptg(97)virihqmnselsvlanfsqpeivpisnitenvyinltcssihgypepkkmsvllrtknstieydgv(162)mqksqdnvtelydvsislsvsfpdvtsnmtifciletdktrllsspfsieledpqpppdhip +linker (2 aa): gt Murine IgG2a Fc +Hinge (233 aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg Predicted monomeric molecular weight: 52.2 kd. The molecule is dimeric and runs at about 115 kd in SDS-PAGE under native conditions.
Transfectant Cell Line
CHO
Performance
CD86(P2)-muIg was reactive in an Enzyme Immuno Assay utilizing a Goat anti-Mouse Ig coated plate for capture and either CD152-muIg/Biotin recombinant protein or anti-CD86/Biotin followed by Streptavidin/HRP and TMB/H2 O2 substrate chromagen for detection. CD86(p2)-muIg bound in FACS to cell surface CD28 present on cultured human T cell leukemic line HPB-MLT. Five x 105 cells per tube were washed and incubated 45 minutes on ice with 80 ul of CD86(P2)-muIg at 10 ug/ml. Cells were washed twice and incubated with 2 degree reagent Goat anti-Mouse IgG/FITC, after which they were washed three times, fixed and analyzed by FACS. Cells stained positive with a mean shift of 0.52 log10 fluorescent units when compared to a recombinant muIg Fc negative control at a similar concentration.
Production
Recombinant protein from (low FBS containing) tissue culture supernatant of transfectants was purified using affinity and size exclusion chromatography.
Buffer
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl. Product was 0.1 um filtered and vialed under aseptic conditions.
Preparation and Storage
Store at 2 - 5 degree C. Open under aseptic conditions. Freeze/Thawing is not recommended.
Product should retain activity for at least 12 months after shipping date when stored as recommended.

Testing Data

Testing Data
Related Product Information for CD86 protein
Information: Human CD86 (B7-2) is a costimulating ligand for CD28 and CTLA-4. CD86 is expressed on activated B cells and blood monocytes(3).
References
1. C. Caux, et al, (1994) J Exp Med 180: 1841-1847. 2. C.B. Thompson, (1995) Cell 81: 979-982. 3. Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 703-705. 4. D. Mauri, et al, (1995) J Immunol 155: 118-127.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
942
UniProt Accession #
Molecular Weight
28,420 Da
NCBI Official Full Name
CD86, partial
NCBI Official Synonym Full Names
CD86 molecule
NCBI Official Symbol
CD86
NCBI Official Synonym Symbols
B70; B7-2; B7.2; LAB72; CD28LG2
NCBI Protein Information
T-lymphocyte activation antigen CD86; BU63; FUN-1; CTLA-4 counter-receptor B7.2; B-lymphocyte activation antigen B7-2; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen)
UniProt Protein Name
T-lymphocyte activation antigen CD86
UniProt Gene Name
CD86
UniProt Synonym Gene Names
CD28LG2
UniProt Entry Name
CD86_HUMAN

NCBI Description

This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.[provided by RefSeq, May 2011]

Uniprot Description

CD86: Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T- cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q21

Cellular Component: cell surface; intracellular membrane-bound organelle; integral to membrane; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; coreceptor activity; receptor activity; receptor binding

Biological Process: positive regulation of lymphotoxin A biosynthetic process; viral reproduction; nerve growth factor receptor signaling pathway; negative regulation of T cell anergy; T cell activation; positive regulation of transcription, DNA-dependent; positive regulation of interleukin-2 biosynthetic process; myeloid dendritic cell differentiation; positive regulation of activated T cell proliferation; positive regulation of interleukin-4 biosynthetic process; positive regulation of T-helper 2 cell differentiation; cell-cell signaling; T cell proliferation during immune response; positive regulation of cell proliferation; response to yeast; defense response to virus; aging; response to drug; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; B cell activation; T cell costimulation; toll-like receptor signaling pathway; innate immune response; immune response

Research Articles on CD86

Similar Products

Product Notes

The CD86 cd86 (Catalog #AAA666863) is a Protein produced from CHO cells and is intended for research purposes only. The product is available for immediate purchase. The CD86(P2)-muIg-Purified Preservative Free reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD86 can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), ELISA (EIA). Researchers should empirically determine the suitability of the CD86 cd86 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD86, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.