Mouse anti-Human HMG2L1 Monoclonal Antibody | anti-HMG2L1 antibody

HMG2L1 (HMG Domain-containing Protein 4, HMG Box-containing Protein 4, High Mobility Group Protein 2-like 1, Protein HMGBCG, HMGXB4, HMGBCG) (Biotin)

Cat. Num. AAA6142301

• Gene Names: HMGXB4; HMG2L1; HMGBCG; THC211630
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HMG2L1; Monoclonal Antibody; HMG2L1 (HMG Domain-containing Protein 4; HMG Box-containing Protein 4; High Mobility Group Protein 2-like 1; Protein HMGBCG; HMGXB4; HMGBCG) (Biotin); anti-HMG2L1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C12
• Specificity: Recognizes human HMG2L1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 4095

• Applicable Applications for anti-HMG2L1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-74 from HMG2L1 (NP_001003681) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.88kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HMG2L1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml])

Product Categories/Family for anti-HMG2L1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519243087
• NCBI GeneID: 10042
• NCBI Accession #: NM_001003681.3
• NCBI GenBank Nucleotide #: NM_001003681
• UniProt Accession #: Q9UGU5
• NCBI Official Full Name: Homo sapiens HMG-box containing 4 (HMGXB4), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: HMG-box containing 4
• NCBI Official Symbol: HMGXB4
• NCBI Official Synonym Symbols: HMG2L1; HMGBCG; THC211630
• NCBI Protein Information: HMG domain-containing protein 4
• UniProt Protein Name: HMG domain-containing protein 4
• UniProt Gene Name: HMGXB4
• UniProt Synonym Gene Names: HMG2L1; HMGBCG
• UniProt Entry Name: HMGX4_HUMAN

NCBI Description

High mobility group (HMG) proteins are nonhistone chromosomal proteins. See HMG2 (MIM 163906) for additional information on HMG proteins.[supplied by OMIM, Nov 2010]

Uniprot Description

HMG2L1: Negatively regulates Wnt/beta-catenin signaling during development.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 22q13.1

Molecular Function: DNA binding; chromatin binding

Biological Process: chromatin remodeling; Wnt receptor signaling pathway; negative regulation of Wnt receptor signaling pathway; regulation of transcription, DNA-dependent; endosome to lysosome transport