CD86 protein

CD86(P2)-muIg-Purified (with Antibiotics)

Cat. Num. AAA666829

• Gene Names: CD86; B70; B7-2; B7.2; LAB72; CD28LG2
• Reactivity: Human
• Applications: Flow Cytometry, Functional Assay, ELISA
• Purity: Purified (with Antibiotics)
• Synonyms: CD86; CD86(P2)-muIg-Purified (with Antibiotics); Human CD86(p2)-muIg Fusion Protein; CD86 protein

• Host: CHO cells
• Reactivity: Human
• Purity/Purification: Purified (with Antibiotics)
• Form/Format: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate
• Concentration: 0.5 mg/ml (varies by lot)
• Sequence Length: 323

• Applicable Applications for CD86 protein: Flow Cytometry (FC/FACS), ELISA (EIA)
• Molecular Structure: A soluble fusion protein consisting of the extracellular (224 aa) domain of human CD86 fused to murine IgG2a Fc region. This molecules contains 1 amino acid polymorphism when compared to Genebank sequence HUMB72A: v(162)i, This residue has not been implicated in the CD86-CD152 binding site(5). CD86 EC (224 aa): (1)aplkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymgrtsfdsdswtlrlhnlqikdkglyqcii(90)rhkkptg(97)virihqmnselsvlanfsqpeivpisnitenvyinltcssihgypepkkmsvllrtknstieydgv(162)mqksqdnvtelydvsislsvsfpdvtsnmtifciletdktrllsspfsieledpqpppdhip +linker (2 aa): gt Murine IgG2a Fc +Hinge (233 aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg Predicted monomeric molecular weight: 52.2 kd. The molecule is dimeric and runs at about 115 kd in SDS-PAGE under native conditions.
• Transfectant Cell Line: CHO
• Performance: CD86(P2)-muIg was reactive in an Enzyme Immuno Assay utilizing a Goat anti-Mouse Ig coated plate for capture and either CD152-muIg/Biotin recombinant protein or anti-CD86/Biotin followed by Streptavidin/HRP and TMB/H2 O2 substrate chromagen for detection. CD86(p2)-muIg bound in FACS to cell surface CD28 present on cultured human T cell leukemic line HPB-MLT. Five x 105 cells per tube were washed and incubated 45 minutes on ice with 80 ul of CD86(P2)-muIg at 10 ug/ml. Cells were washed twice and incubated with 2 degree reagent Goat anti-Mouse IgG/FITC, after which they were washed three times, fixed and analyzed by FACS. Cells stained positive with a mean shift of 0.52 log10 fluorescent units when compared to a recombinant muIg Fc negative control at a similar concentration.
• Production: Recombinant protein from (low FBS containing) tissue culture supernatant of transfectants was purified using affinity and size exclusion chromatography.
• Buffer: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5 mg/ml Gentamicin Sulfate (as a preservative).
• Group Header: CD86(P2)-muIg
• Preparation and Storage: Store at 2 - 5 degree C. Freeze/Thawing is not recommended.; Product should retain activity for at least 12 months after shipping date when stored as recommended.

Testing Data

Related Product Information for CD86 protein

Information: Human CD86 (B7-2) is a costimulating ligand for CD28 and CTLA-4. CD86 is expressed on activated B cells and blood monocytes(3).

References

1. C. Caux, et al, (1994) J Exp Med 180: 1841-1847. 2. C.B. Thompson, (1995) Cell 81: 979-982. 3. Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 703-705. 4. D. Mauri, et al, (1995) J Immunol 155: 118-127.

NCBI and Uniprot Product Information

• NCBI GI #: 49456643
• NCBI GeneID: 942
• UniProt Accession #: P42081; Q13655; Q6FHB1; Q6GTS4; Q7M4L5; A0N0P0; B7Z2F3; B7Z702; E7ETN5; E9PC27
• Molecular Weight: 28,420 Da
• NCBI Official Full Name: CD86, partial
• NCBI Official Synonym Full Names: CD86 molecule
• NCBI Official Symbol: CD86
• NCBI Official Synonym Symbols: B70; B7-2; B7.2; LAB72; CD28LG2
• NCBI Protein Information: T-lymphocyte activation antigen CD86; BU63; FUN-1; CTLA-4 counter-receptor B7.2; B-lymphocyte activation antigen B7-2; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen)
• UniProt Protein Name: T-lymphocyte activation antigen CD86
• Protein Family: T-lymphocyte activation antigen
• UniProt Gene Name: CD86
• UniProt Synonym Gene Names: CD28LG2
• UniProt Entry Name: CD86_HUMAN

NCBI Description

This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.[provided by RefSeq, May 2011]

Uniprot Description

CD86: Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T- cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 3q21

Cellular Component: cell surface; intracellular membrane-bound organelle; plasma membrane; integral to membrane; external side of plasma membrane

Molecular Function: protein binding; coreceptor activity; receptor activity; receptor binding

Biological Process: positive regulation of lymphotoxin A biosynthetic process; negative regulation of T cell anergy; nerve growth factor receptor signaling pathway; viral reproduction; T cell activation; positive regulation of interleukin-2 biosynthetic process; positive regulation of transcription, DNA-dependent; myeloid dendritic cell differentiation; positive regulation of activated T cell proliferation; positive regulation of interleukin-4 biosynthetic process; positive regulation of T-helper 2 cell differentiation; cell-cell signaling; T cell proliferation during immune response; positive regulation of cell proliferation; response to yeast; defense response to virus; aging; epidermal growth factor receptor signaling pathway; response to drug; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; B cell activation; T cell costimulation; toll-like receptor signaling pathway; innate immune response; immune response