CD27 ligand, soluble Active Protein | CD27 ligand active protein
Human CD27 ligand, soluble
Gene Names
CD70; CD27L; CD27LG; TNFSF7
Reactivity
Human
Purity
> 95% by SDS-PAGE gel and HPLC analyses.
Synonyms
CD27 ligand; soluble; Human CD27 ligand; CD70; CD27L; CD27LG; TNFSF7; CD27 ligand active protein
Host
CHO Cells
Reactivity
Human
Purity/Purification
> 95% by SDS-PAGE gel and HPLC analyses.
Form/Format
Lyophilized
Sequence
HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPR LYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASR HHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLT GTLLPSRNTDETFFGVQWVRP
Sequence Length
193
Label/Conjugation
His-Tag
Biological Activity
Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors.
Related Product Information for CD27 ligand active protein
CD27 Ligand, a type II transmembrane protein, is a member of the TNF superfamily. It is expressed on activated T and B lymphocytes as well as NK cells. CD27L and its receptor (CD27) regulate the immune response by promoting T-cell expansion and differentiation, as well as NK enhancement. CD27 signaling can act as a co-stimulatory effector to sustain the survival of CD8+ T cells, primarily by inducing increased expression of the IL-2 gene. Full length human CD27L is a 193 amino acid protein, consisting of a 17 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 155 amino acid extracellular domain. Human soluble CD27L corresponds to the 155 amino acid extracellular domain of the full length CD27L protein. The provided human sCD27L protein contains the extracellular domain plus an N-terminal His-Tag.
Product Categories/Family for CD27 ligand active protein
References
Croft M., Nat Rev Immunol. 2009 April; 9(4): 271 -285.; Nolte MA et al., Immunol Rev. 2009 May;229(1):216-31; Goodwin RG et al., Cell. 1993 May 7;73(3):447-56.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,118 Da
NCBI Official Full Name
CD70 antigen
NCBI Official Synonym Full Names
CD70 molecule
NCBI Official Symbol
CD70
NCBI Official Synonym Symbols
CD27L; CD27LG; TNFSF7
NCBI Protein Information
CD70 antigen; CD27-L; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand superfamily member 7; tumor necrosis factor (ligand) superfamily, member 7
UniProt Protein Name
CD70 antigen
UniProt Gene Name
CD70
UniProt Synonym Gene Names
CD27L; CD27LG; TNFSF7; CD27-L
UniProt Entry Name
CD70_HUMAN
NCBI Description
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]
Uniprot Description
Function: Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Subunit structure: Homotrimer
Probable.
Subcellular location: Membrane; Single-pass type II membrane protein.
Sequence similarities: Belongs to the tumor necrosis factor family.
Research Articles on CD27 ligand
Similar Products
Product Notes
The CD27 ligand cd70 (Catalog #AAA691798) is an Active Protein produced from CHO Cells and is intended for research purposes only. The product is available for immediate purchase. The Human CD27 ligand, soluble reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: HHHHHHHHPS PGGSGGQRFA QAQQQLPLES LGWDVAELQL NHTGPQQDPR LYWQGGPALG RSFLHGPELD KGQLRIHRDG IYMVHIQVTL AICSSTTASR HHPTTLAVGI CSPASRSISL LRLSFHQGCT IASQRLTPLA RGDTLCTNLT GTLLPSRNTD ETFFGVQWVR P. It is sometimes possible for the material contained within the vial of "CD27 ligand, soluble, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
