Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD70 recombinant protein

CD70 Recombinant Protein

Gene Names
CD70; CD27L; CD27LG; TNFSF7
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD70; CD70 Recombinant Protein; CD70 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
477
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD70 recombinant protein
Background: CD70 is a type II transmembrane glycoprotein and a member of the tumor necrosis factor ligand superfamily (TNFSF), also known as CD27L and TNFSF7. It is normally expressed on medullary thymic epithelial cells. Its expression is induced on activated lymphoid cells (B cells, T cells, and NK cells) and dendritic cells. CD70 is a ligand for CD27, a co-stimulatory receptor that plays an important role in T cell activation and proliferation. CD70 overexpression has been reported in various tumors such as renal cell carcinoma, glioblastoma, and non-small cell lung carcinoma and it's being actively pursued as a therapeutic target.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
970
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,118 Da
NCBI Official Full Name
CD70 antigen
NCBI Official Synonym Full Names
CD70 molecule
NCBI Official Symbol
CD70
NCBI Official Synonym Symbols
CD27L; CD27LG; TNFSF7
NCBI Protein Information
CD70 antigen; CD27-L; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand superfamily member 7; tumor necrosis factor (ligand) superfamily, member 7
UniProt Protein Name
CD70 antigen
Protein Family
UniProt Gene Name
CD70
UniProt Synonym Gene Names
CD27L; CD27LG; TNFSF7; CD27-L
UniProt Entry Name
CD70_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]

Uniprot Description

CD70: Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells. Belongs to the tumor necrosis factor family.

Protein type: Cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13

Cellular Component: extracellular space; integral to plasma membrane; plasma membrane

Molecular Function: protein binding; protease binding; cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: cell proliferation; cell-cell signaling; immune response; signal transduction

Research Articles on CD70

Similar Products

Product Notes

The CD70 cd70 (Catalog #AAA3003695) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QRFAQAQQQL PLESLGWDVA ELQLNHTGPQ QDPRLYWQGG PALGRSFLHG PELDKGQLRI HRDGIYMVHI QVTLAICSST TASRHHPTTL AVGICSPASR SISLLRLSFH QGCTIASQRL TPLARGDTLC TNLTGTLLPS RNTDETFFGV QWVRP. It is sometimes possible for the material contained within the vial of "CD70, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.