Properdin (CFP) Recombinant Protein | CFP recombinant protein
Recombinant Human Properdin (CFP)
Gene Names
CFP; BFD; PFC; PFD; PROPERDIN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Properdin (CFP); Recombinant Human Properdin (CFP); CFP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-469, Full length protein
Sequence
DPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL
Sequence Length
442
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,276 Da
NCBI Official Full Name
properdin
NCBI Official Synonym Full Names
complement factor properdin
NCBI Official Symbol
CFP
NCBI Official Synonym Symbols
BFD; PFC; PFD; PROPERDIN
NCBI Protein Information
properdin
UniProt Protein Name
Properdin
Protein Family
UniProt Gene Name
CFP
UniProt Synonym Gene Names
PFC
NCBI Description
This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.[provided by RefSeq, Feb 2009]
Uniprot Description
A positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes.
Research Articles on CFP
Similar Products
Product Notes
The CFP cfp (Catalog #AAA949431) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-469, Full length protein. The amino acid sequence is listed below: DPVLCFTQYE ESSGKCKGLL GGGVSVEDCC LNTAFAYQKR SGGLCQPCRS PRWSLWSTWA PCSVTCSEGS QLRYRRCVGW NGQCSGKVAP GTLEWQLQAC EDQQCCPEMG GWSGWGPWEP CSVTCSKGTR TRRRACNHPA PKCGGHCPGQ AQESEACDTQ QVCPTHGAWA TWGPWTPCSA SCHGGPHEPK ETRSRKCSAP EPSQKPPGKP CPGLAYEQRR CTGLPPCPVA GGWGPWGPVS PCPVTCGLGQ TMEQRTCNHP VPQHGGPFCA GDATRTHICN TAVPCPVDGE WDSWGEWSPC IRRNMKSISC QEIPGQQSRG RTCRGRKFDG HRCAGQQQDI RHCYSIQHCP LKGSWSEWST WGLCMPPCGP NPTRARQRLC TPLLPKYPPT VSMVEGQGEK NVTFWGRPLP RCEELQGQKL VVEEKRPCLH VPACKDPEEE EL. It is sometimes possible for the material contained within the vial of "Properdin (CFP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
