Flow Cytometry (FC/FACS)
(Fig-1: Detection of human NKp46 in the CHO-K1/NKp46 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/NKp46 cells (Red).)
NKp46 cell line
NKp46 Stable Cell Line
Gene Names
NCR1; LY94; CD335; NKP46; NK-p46
Applications
Flow Cytometry, Functional Assay, Immunocytochemistry, Western Blot
Synonyms
NKp46; NKp46 Stable Cell Line; NCR1; CD335; Functional Assay; NKp46 cell line
Form/Format
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
Sequence
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQL HFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEM YDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPV TTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTET GLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLN TQTL
Sequence Length
1153
Applicable Applications for NKp46 cell line
Flow Cytometry (FC/FACS), Immunocytochemistry (ICC), Western Blot (WB)
Application Notes
Culture conditions: Cells should be grown at 37 degree C with 5% CO2 using DMEM medium supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37 degree C-CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1: 10 to 1: 20 weekly.
Shipping Note
Product available only in the USA.
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Immediately upon receipt, store in liquid nitrogen.
Flow Cytometry (FC/FACS)
(Fig-1: Detection of human NKp46 in the CHO-K1/NKp46 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/NKp46 cells (Red).)
Flow Cytometry (FC/FACS)
(Fig-1: Detection of human NKp46 in the CHO-K1/NKp46 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/NKp46 cells (Red).)
Related Product Information for NKp46 cell line
NKp46 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human activating Natural Killer cell receptor 46 (NKp46, also known as Natural Cytotoxicity triggering Receptor 1 (NCR1) or CD335).
Product Categories/Family for NKp46 cell line
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,409 Da
NCBI Official Full Name
Homo sapiens natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
natural cytotoxicity triggering receptor 1
NCBI Official Symbol
NCR1
NCBI Official Synonym Symbols
LY94; CD335; NKP46; NK-p46
NCBI Protein Information
natural cytotoxicity triggering receptor 1
UniProt Protein Name
Natural cytotoxicity triggering receptor 1
UniProt Gene Name
NCR1
UniProt Synonym Gene Names
LY94; NK-p46; NKp46; hNKp46
Uniprot Description
Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
Research Articles on NKp46
Similar Products
Product Notes
The NKp46 ncr1 (Catalog #AAA669113) is a Cell Line and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NKp46 can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), Immunocytochemistry (ICC), Western Blot (WB). Culture conditions: Cells should be grown at 37 degree C with 5% CO2 using DMEM medium supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37 degree C-CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1: 10 to 1: 20 weekly. Researchers should empirically determine the suitability of the NKp46 ncr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSTLPALLC VGLCLSQRIS AQQQTLPKPF IWAEPHFMVP KEKQVTICCQ GNYGAVEYQL HFEGSLFAVD RPKPPERINK VQFYIPDMNS RMAGQYSCIY RVGELWSEPS NLLDLVVTEM YDTPTLSVHP GPEVISGEKV TFYCRLDTAT SMFLLLKEGR SSHVQRGYGK VQAEFPLGPV TTAHRGTYRC FGSYNNHAWS FPSEPVKLLV TGDIENTSLA PEDPTFPADT WGTYLLTTET GLQKDHALWD HTAQNLLRMG LAFLVLVALV WFLVEDWLSR KRTRERASRA STWEGRRRLN TQTL. It is sometimes possible for the material contained within the vial of "NKp46, Cell Line" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
