Putative cat eye syndrome critical region protein 9 (CECR9) Recombinant Protein | CECR9 recombinant protein

Recombinant Human Putative cat eye syndrome critical region protein 9 (CECR9)

Cat. Num. AAA963654

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Putative cat eye syndrome critical region protein 9 (CECR9); Recombinant Human Putative cat eye syndrome critical region protein 9 (CECR9); CECR9 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-216, Full length protein
• Sequence: AQPEDRRVLRYPGTAVMVTCPNRPLVPRPLLTPGGSRASLALCAFVAVPQRIPQPLLPAYILLMLPSLVVDMALPSSRLLRSIKPIQPASQVVRKERNPNPNCPQSDPLMKASSTSFLSHTYLINKTRSTTRKVEEHSWFTCTGAKYFAIPLAERNTKRLTKRSTHAQLLRGKQDGSEWVVPRSSASSNVLYH
• Sequence Length: 193

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 205690431
• UniProt Accession #: P0C854
• Molecular Weight: 23,602 Da
• NCBI Official Full Name: Putative cat eye syndrome critical region protein 9
• UniProt Protein Name: Putative cat eye syndrome critical region protein 9
• Protein Family: Putative cat eye syndrome critical region protein
• UniProt Gene Name: CECR9

Uniprot Description

MiscellaneousCandidate gene for the Cat Eye Syndrome (CES), a developmental disorder associated with the duplication of a 2 Mb region of 22q11.2. Duplication usually takes in the form of a surpernumerary bisatellited isodicentric chromosome, resulting in four copies of the region (represents an inv dup(22)(q11)). CES is characterized clinically by the combination of coloboma of the iris and anal atresia with fistula, downslanting palpebral fissures, preauricular tags and/or pits, frequent occurrence of heart and renal malformations, and normal or near-normal mental development.