CCAAT/enhancer-binding protein delta (CEBPD) Recombinant Protein | CEBPD recombinant protein

Recombinant Human CCAAT/enhancer-binding protein delta (CEBPD)

Cat. Num. AAA718452

• Gene Names: CEBPD; CELF; CRP3; C/EBP-delta; NF-IL6-beta
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: CCAAT/enhancer-binding protein delta (CEBPD); Recombinant Human CCAAT/enhancer-binding protein delta (CEBPD); CEBPD recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-269aa; Full Length of Mature Protein
• Sequence: SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
• Sequence Length: 269

• Species: Human
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for CEBPD recombinant protein

The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and
or differentiation of macrophages.

NCBI and Uniprot Product Information

• NCBI GI #: 28872798
• NCBI GeneID: 1052
• NCBI Accession #: NP_005186.2
• NCBI GenBank Nucleotide #: NM_005195.3
• UniProt Accession #: P49716; Q14937; Q2M2X9
• Molecular Weight: 35.8 kDa
• NCBI Official Full Name: CCAAT/enhancer-binding protein delta
• NCBI Official Synonym Full Names: CCAAT enhancer binding protein delta
• NCBI Official Symbol: CEBPD
• NCBI Official Synonym Symbols: CELF; CRP3; C/EBP-delta; NF-IL6-beta
• NCBI Protein Information: CCAAT/enhancer-binding protein delta
• UniProt Protein Name: CCAAT/enhancer-binding protein delta
• Protein Family: CCAAT/enhancer-binding protein
• UniProt Gene Name: CEBPD
• UniProt Synonym Gene Names: NF-IL6-beta

NCBI Description

The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. The cytogenetic location of this locus has been reported as both 8p11 and 8q11. [provided by RefSeq, Sep 2010]

Uniprot Description

Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:16397300). Important transcription factor regulating the expression of genes involved in immune and inflammatory responses (PubMed:1741402, PubMed:16397300). Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB (PubMed:1741402).