Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CEBPDSample Tissue: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CEBPD Polyclonal Antibody | anti-CEBPD antibody

CEBPD Antibody - middle region

Gene Names
CEBPD; CELF; CRP3; C/EBP-delta; NF-IL6-beta
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CEBPD; Polyclonal Antibody; CEBPD Antibody - middle region; anti-CEBPD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 11% sucrose.
Sequence
Synthetic peptide located within the following region: QTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEM
Sequence Length
269
Applicable Applications for anti-CEBPD antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CEBPD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CEBPDSample Tissue: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CEBPDSample Tissue: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CEBPD antibody
The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. The cytogenetic location of this locus has been reported as both 8p11 and 8q11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Full Name
CCAAT/enhancer-binding protein delta
NCBI Official Synonym Full Names
CCAAT enhancer binding protein delta
NCBI Official Symbol
CEBPD
NCBI Official Synonym Symbols
CELF; CRP3; C/EBP-delta; NF-IL6-beta
NCBI Protein Information
CCAAT/enhancer-binding protein delta
UniProt Protein Name
CCAAT/enhancer-binding protein delta
UniProt Gene Name
CEBPD
UniProt Synonym Gene Names
C/EBP delta; NF-IL6-beta
UniProt Entry Name
CEBPD_HUMAN

NCBI Description

The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. The cytogenetic location of this locus has been reported as both 8p11 and 8q11. [provided by RefSeq, Sep 2010]

Uniprot Description

C/EBP-delta: C/EBP is a DNA-binding protein that recognizes two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Important transcriptional activator in the regulation of genes involved in immune and inflammatory responses, may play an important role in the regulation of the several genes associated with activation and/or differentiation of macrophages. Binds DNA as a dimer and can form stable heterodimers with C/EBP alpha. Interacts with SPI1/PU.1. Interacts with PRDM16. Belongs to the bZIP family. C/EBP subfamily.

Protein type: DNA-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p11.2-p11.1

Cellular Component: nucleus

Biological Process: transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter

Research Articles on CEBPD

Similar Products

Product Notes

The CEBPD cebpd (Catalog #AAA3220196) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEBPD Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEBPD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEBPD cebpd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QTPAPGPARE KSAGKRGPDR GSPEYRQRRE RNNIAVRKSR DKAKRRNQEM. It is sometimes possible for the material contained within the vial of "CEBPD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.