Phosphatidate cytidylyltransferase (CDS1) Recombinant Protein | CDS1 recombinant protein
Recombinant Saccharomyces cerevisiae Phosphatidate cytidylyltransferase (CDS1)
Gene Names
CDS1; CDG1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidate cytidylyltransferase (CDS1); Recombinant Saccharomyces cerevisiae Phosphatidate cytidylyltransferase (CDS1); CDS1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-457aa; full length protein
Sequence
MSDNPEMKPHGTSKEIVESVTDATSKAIDKLQEELHKDASESVTPVTKESTAATKESRKY NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNLPLTKT LNWYLLFTTIYYLDGKSLFKFFQATFYEYPVLNFIVTNHKFICYCLYLMGFVLFVCSLRK GFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLCGITFG KTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTNFFSNLTCELN PVFLPQVYRLPPIFFDKVQINSITVKPIYFHALNLATFASLFAPFGGFFASGLKRTFKVK DFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTILMNLNDKQIIEL IDILIRFLSKKGIISAKNFEKLADIFNVTKKSLTNHS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CDS1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,823 Da
NCBI Official Full Name
phosphatidate cytidylyltransferase
NCBI Official Symbol
CDS1
NCBI Official Synonym Symbols
CDG1
NCBI Protein Information
phosphatidate cytidylyltransferase
UniProt Protein Name
Phosphatidate cytidylyltransferase
Protein Family
UniProt Gene Name
CDS1
UniProt Synonym Gene Names
CDG1; CDP-DAG synthase; CDS; CDP-DG synthase
UniProt Entry Name
CDS1_YEAST
Uniprot Description
Supplies CDP-diacylglycerol, which may play an important role as both a precursor to phosphoinositide biosynthesis in the plasma membrane and as a negative effector of phosphatidylinositol 4-kinase activity, thereby exerting an effect on cell proliferation via a lipid-dependent signal transduction cascade.
Similar Products
Product Notes
The CDS1 cds1 (Catalog #AAA7011225) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-457aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CDS1 cds1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSDNPEMKPH GTSKEIVESV TDATSKAIDK LQEELHKDAS ESVTPVTKES TAATKESRKY NFFIRTVWTF VMISGFFITL ASGHAWCIVL ILGCQIATFK ECIAVTSASG REKNLPLTKT LNWYLLFTTI YYLDGKSLFK FFQATFYEYP VLNFIVTNHK FICYCLYLMG FVLFVCSLRK GFLKFQFGSL CVTHMVLLLV VFQAHLIIKN VLNGLFWFLL PCGLVIVNDI FAYLCGITFG KTKLIEISPK KTLEGFLGAW FFTALASIIL TRILSPYTYL TCPVEDLHTN FFSNLTCELN PVFLPQVYRL PPIFFDKVQI NSITVKPIYF HALNLATFAS LFAPFGGFFA SGLKRTFKVK DFGHSIPGHG GITDRVDCQF IMGSFANLYY ETFISEHRIT VDTVLSTILM NLNDKQIIEL IDILIRFLSK KGIISAKNFE KLADIFNVTK KSLTNHS. It is sometimes possible for the material contained within the vial of "Phosphatidate cytidylyltransferase (CDS1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
