Cyclin-dependent kinase inhibitor 1C (Cdkn1c) Recombinant Protein | Cdkn1c recombinant protein
Recombinant Mouse Cyclin-dependent kinase inhibitor 1C (Cdkn1c)
Gene Names
Cdkn1c; CDKI; Kip2; p57Kip2; AL024410; p57(kip2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-dependent kinase inhibitor 1C (Cdkn1c); Recombinant Mouse Cyclin-dependent kinase inhibitor 1C (Cdkn1c); Cdkn1c recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-348, Full length protein
Sequence
MGMSDVYLRSRTAMERLASSDTFPVIARSSACRSLFGPVDHEELGRELRMRLAELNAEDQNRWDFNFQQDVPLRGPGRLQWMEVDSESVPAFYRETVQVGRCRLQLGPRPPPVAVAVIPRSGPPAGEAPDGLEEAPEQPPSAPASAVVAEPTPPATPAPASDLTSDPIPEVTLVATSDPTPDPIPDANPDVATRDGEEQVPEQVSEQGEESGAEPGDELGTEPVSEQGEEQGAEPVEEKDEEPEEEQGAEPVEEQGAEPVEEQNGEPVEEQDENQEQRGQELKDQPLSGIPGRPAPGTAAANANDFFAKRKRTAQENKASNDVPPGCPSPNVAPGVGAVEQTPRKRLR
Sequence Length
348
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cdkn1c recombinant protein
This protein is a tight-binding, strong inhibitor of several G1 cyclin
Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene.
Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,903 Da
NCBI Official Full Name
cyclin-dependent kinase inhibitor 1C isoform 1
NCBI Official Synonym Full Names
cyclin-dependent kinase inhibitor 1C (P57)
NCBI Official Symbol
Cdkn1c
NCBI Official Synonym Symbols
CDKI; Kip2; p57Kip2; AL024410; p57(kip2)
NCBI Protein Information
cyclin-dependent kinase inhibitor 1C
UniProt Protein Name
Cyclin-dependent kinase inhibitor 1C
Protein Family
UniProt Gene Name
Cdkn1c
UniProt Synonym Gene Names
Kip2
Uniprot Description
Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life.
Research Articles on Cdkn1c
Similar Products
Product Notes
The Cdkn1c cdkn1c (Catalog #AAA965061) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-348, Full length protein. The amino acid sequence is listed below: MGMSDVYLRS RTAMERLASS DTFPVIARSS ACRSLFGPVD HEELGRELRM RLAELNAEDQ NRWDFNFQQD VPLRGPGRLQ WMEVDSESVP AFYRETVQVG RCRLQLGPRP PPVAVAVIPR SGPPAGEAPD GLEEAPEQPP SAPASAVVAE PTPPATPAPA SDLTSDPIPE VTLVATSDPT PDPIPDANPD VATRDGEEQV PEQVSEQGEE SGAEPGDELG TEPVSEQGEE QGAEPVEEKD EEPEEEQGAE PVEEQGAEPV EEQNGEPVEE QDENQEQRGQ ELKDQPLSGI PGRPAPGTAA ANANDFFAKR KRTAQENKAS NDVPPGCPSP NVAPGVGAVE QTPRKRLR. It is sometimes possible for the material contained within the vial of "Cyclin-dependent kinase inhibitor 1C (Cdkn1c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
