Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDKN1CSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CDKN1C Polyclonal Antibody | anti-CDKN1C antibody

CDKN1C Antibody - middle region

Gene Names
CDKN1C; BWS; WBS; p57; BWCR; KIP2; p57Kip2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDKN1C; Polyclonal Antibody; CDKN1C Antibody - middle region; anti-CDKN1C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRL
Sequence Length
316
Applicable Applications for anti-CDKN1C antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CDKN1C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDKN1CSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDKN1CSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CDKN1C antibody
This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-CDKN1C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
cyclin-dependent kinase inhibitor 1C isoform a
NCBI Official Synonym Full Names
cyclin dependent kinase inhibitor 1C
NCBI Official Symbol
CDKN1C
NCBI Official Synonym Symbols
BWS; WBS; p57; BWCR; KIP2; p57Kip2
NCBI Protein Information
cyclin-dependent kinase inhibitor 1C
UniProt Protein Name
Cyclin-dependent kinase inhibitor 1C
UniProt Gene Name
CDKN1C
UniProt Synonym Gene Names
KIP2
UniProt Entry Name
CDN1C_HUMAN

NCBI Description

This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]

Uniprot Description

p57Kip2: Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non- proliferative state throughout life. Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. High levels are seen in the placenta while low levels are seen in the liver. Belongs to the CDI family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Inhibitor; Nuclear receptor co-regulator; Tumor suppressor

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: cytoplasm; nucleus

Molecular Function: cyclin-dependent protein kinase inhibitor activity; protein binding

Biological Process: negative regulation of kinase activity; camera-type eye development; adrenal gland development; multicellular organism growth; positive regulation of transcription, DNA-dependent; regulation of mitotic cell cycle; positive regulation of transforming growth factor beta receptor signaling pathway; negative regulation of transcription from RNA polymerase II promoter; uterus development; neuron maturation; negative regulation of phosphorylation; myeloid cell differentiation; cell cycle arrest; negative regulation of transcription, DNA-dependent; kidney development; skeletal development; aging; negative regulation of epithelial cell proliferation

Disease: Intrauterine Growth Retardation, Metaphyseal Dysplasia, Adrenal Hypoplasia Congenita, And Genital Anomalies; Beckwith-wiedemann Syndrome

Research Articles on CDKN1C

Similar Products

Product Notes

The CDKN1C cdkn1c (Catalog #AAA3220763) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDKN1C Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKN1C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDKN1C cdkn1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SACRSLFGPV DHEELSRELQ ARLAELNAED QNRWDYDFQQ DMPLRGPGRL. It is sometimes possible for the material contained within the vial of "CDKN1C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.