Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cyclin-dependent kinase 13 (CDK13) Recombinant Protein | CDK13 recombinant protein

Recombinant Human Cyclin-dependent kinase 13 (CDK13) , partial

Gene Names
CDK13; CHED; CDC2L; CDC2L5; hCDK13; CHDFIDD
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-dependent kinase 13 (CDK13); Recombinant Human Cyclin-dependent kinase 13 (CDK13); partial; CDK13 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
694-1039aa; Partial
Sequence
DIDWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRRQKQMGMTDDVST
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
158,435 Da
NCBI Official Full Name
cyclin-dependent kinase 13 isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase 13
NCBI Official Symbol
CDK13
NCBI Official Synonym Symbols
CHED; CDC2L; CDC2L5; hCDK13; CHDFIDD
NCBI Protein Information
cyclin-dependent kinase 13
UniProt Protein Name
Cyclin-dependent kinase 13
Protein Family
UniProt Gene Name
CDK13
UniProt Synonym Gene Names
CDC2L; CDC2L5; CHED; KIAA1791; hCDK13

NCBI Description

The protein encoded by this gene is a member of the cyclin-dependent serine/threonine protein kinase family. Members of this family are well known for their essential roles as master switches in cell cycle control. The exact function of this protein has not yet been determined, but it may play a role in mRNA processing and may be involved in regulation of hematopoiesis. Alternatively spliced transcript variants have been described.[provided by RefSeq, Dec 2009]

Uniprot Description

Cyclin-dependent kinase which displays CTD kinase activity and is required for RNA splicing. Has CTD kinase activity by hyperphosphorylating the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit RPB1, thereby acting as a key regulator of transcription elongation. Required for RNA splicing, probably by phosphorylating SRSF1/SF2. Required during hematopoiesis. In case of infection by HIV-1 virus, interacts with HIV-1 Tat protein acetylated at 'Lys-50' and 'Lys-51', thereby increasing HIV-1 mRNA splicing and promoting the production of the doubly spliced HIV-1 protein Nef.

Research Articles on CDK13

Similar Products

Product Notes

The CDK13 cdk13 (Catalog #AAA1306830) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 694-1039aa; Partial. The amino acid sequence is listed below: DIDWGKRCVD KFDIIGIIGE GTYGQVYKAR DKDTGEMVAL KKVRLDNEKE GFPITAIREI KILRQLTHQS IINMKEIVTD KEDALDFKKD KGAFYLVFEY MDHDLMGLLE SGLVHFNENH IKSFMRQLME GLDYCHKKNF LHRDIKCSNI LLNNRGQIKL ADFGLARLYS SEESRPYTNK VITLWYRPPE LLLGEERYTP AIDVWSCGCI LGELFTKKPI FQANQELAQL ELISRICGSP CPAVWPDVIK LPYFNTMKPK KQYRRKLREE FVFIPAAALD LFDYMLALDP SKRCTAEQAL QCEFLRDVEP SKMPPPDLPL WQDCHELWSK KRRRQKQMGM TDDVST . It is sometimes possible for the material contained within the vial of "Cyclin-dependent kinase 13 (CDK13), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.