Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Cadherin-3/CDH3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

Cadherin-3/CDH3 Recombinant Protein | CDH3 recombinant protein

Recombinant Human Cadherin-3/CDH3 Protein

Gene Names
CDH3; CDHP; HJMD; PCAD
Purity
>95% by SDS-PAGE.
Synonyms
Cadherin-3/CDH3; Recombinant Human Cadherin-3/CDH3 Protein; Cadherin-3; Placental Cadherin; P-Cadherin; CDH3; CDHP; CDH3 recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
EPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPGQEPALFSTDNDDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQMTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTI
Sequence Length
829
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Cadherin-3/CDH3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human Cadherin-3/CDH3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for CDH3 recombinant protein
Recombinant Human Cadherin-3/CDH3 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Glu25-Gly654) of human Cadherin-3/CDH3 (Accession #P22223) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for CDH3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cadherin-3 isoform 1 preproprotein
NCBI Official Synonym Full Names
cadherin 3
NCBI Official Symbol
CDH3
NCBI Official Synonym Symbols
CDHP; HJMD; PCAD
NCBI Protein Information
cadherin-3
UniProt Protein Name
Cadherin-3
UniProt Gene Name
CDH3
UniProt Synonym Gene Names
CDHP; P-cadherin
UniProt Entry Name
CADH3_HUMAN

NCBI Description

This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in this gene are associated with hypotrichosis with juvenile macular dystrophy and ectodermal dysplasia, ectrodactyly, and macular dystrophy syndrome (EEMS). [provided by RefSeq, Nov 2015]

Uniprot Description

CDH3: Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. Interacts with CDCP1. Expressed in some normal epithelial tissues and in some carcinoma cell lines. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: cell-cell adherens junction; cytoplasm; integral to membrane; plasma membrane

Molecular Function: calcium ion binding

Biological Process: response to drug; positive regulation of insulin-like growth factor receptor signaling pathway; intercellular junction assembly and maintenance; wound healing; positive regulation of melanin biosynthetic process; Wnt receptor signaling pathway through beta-catenin; retinal homeostasis; negative regulation of transforming growth factor-beta2 production; hair cycle process; cell-cell adhesion; positive regulation of monophenol monooxygenase activity; negative regulation of catagen; visual perception; keratinization; cell adhesion; homophilic cell adhesion

Disease: Ectodermal Dysplasia, Ectrodactyly, And Macular Dystrophy Syndrome; Hypotrichosis, Congenital, With Juvenile Macular Dystrophy

Research Articles on CDH3

Similar Products

Product Notes

The CDH3 cdh3 (Catalog #AAA9140297) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: EPCRAVFREA EVTLEAGGAE QEPGQALGKV FMGCPGQEPA LFSTDNDDFT VRNGETVQER RSLKERNPLK IFPSKRILRR HKRDWVVAPI SVPENGKGPF PQRLNQLKSN KDRDTKIFYS ITGPGADSPP EGVFAVEKET GWLLLNKPLD REEIAKYELF GHAVSENGAS VEDPMNISII VTDQNDHKPK FTQDTFRGSV LEGVLPGTSV MQMTATDEDD AIYTYNGVVA YSIHSQEPKD PHDLMFTIHR STGTI. It is sometimes possible for the material contained within the vial of "Cadherin-3/CDH3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.