Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human MMP-2/72 kDa type IV collagenase Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

MMP-2/72 kDa type IV collagenase Recombinant Protein | MMP-2 recombinant protein

Recombinant Human MMP-2/72 kDa Type IV Collagenase Protein

Gene Names
MMP2; CLG4; MONA; CLG4A; MMP-2; TBE-1; MMP-II
Purity
>95% by SDS-PAGE.
Synonyms
MMP-2/72 kDa type IV collagenase; Recombinant Human MMP-2/72 kDa Type IV Collagenase Protein; 72 kDa Type IV Collagenase; 72 kDa Gelatinase; Gelatinase A; Matrix Metalloproteinase-2; MMP-2; TBE-1; MMP2; CLG4A; MMP-2 recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 150mM NaCl, pH7.5.
Sequence
APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGG
Sequence Length
610
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human MMP-2/72 kDa type IV collagenase Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human MMP-2/72 kDa type IV collagenase Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for MMP-2 recombinant protein
Recombinant Human MMP-2/72 kDa type IV collagenase Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala30-Cys660) of human MMP-2/72 kDa type IV collagenase (Accession #P08253) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for MMP-2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
72 kDa type IV collagenase isoform 2
NCBI Official Synonym Full Names
matrix metallopeptidase 2
NCBI Official Symbol
MMP2
NCBI Official Synonym Symbols
CLG4; MONA; CLG4A; MMP-2; TBE-1; MMP-II
NCBI Protein Information
72 kDa type IV collagenase
UniProt Protein Name
72 kDa type IV collagenase
UniProt Gene Name
MMP2
UniProt Synonym Gene Names
CLG4A; MMP-2
UniProt Entry Name
MMP2_HUMAN

NCBI Description

This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of denatured type IV and V collagen and elastin. Unlike most MMP family members, activation of this protein can occur on the cell membrane. This enzyme can be activated extracellularly by proteases, or, intracellulary by its S-glutathiolation with no requirement for proteolytical removal of the pro-domain. This protein is thought to be involved in multiple pathways including roles in the nervous system, endometrial menstrual breakdown, regulation of vascularization, and metastasis. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]

Uniprot Description

MMP2: Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Interacts (via the C-terminal hemopexin-like domains- containing region) with the integrin alpha-V/beta-3; the interaction promotes vascular invasion in angiogenic vessels and melamoma cells. Interacts (via the C-terminal PEX domain) with TIMP2 (via the C-terminal); the interaction inhibits the degradation activity. Interacts with GSK3B. Aspirin appears to inhibit expression. Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate. Inhibited by histatin-3 1/24 (histatin-5). Belongs to the peptidase M10A family.

Protein type: Cell development/differentiation; Apoptosis; Motility/polarity/chemotaxis; Protease; Secreted, signal peptide; EC 3.4.24.24; Secreted

Chromosomal Location of Human Ortholog: 16q12.2

Cellular Component: proteinaceous extracellular matrix; extracellular space; sarcomere; mitochondrion; extracellular region; plasma membrane; nucleus

Molecular Function: protein binding; zinc ion binding; metalloendopeptidase activity; serine-type endopeptidase activity

Biological Process: axon guidance; extracellular matrix organization and biogenesis; intramembranous ossification; proteolysis; blood vessel maturation; collagen catabolic process; extracellular matrix disassembly; cellular protein metabolic process; positive regulation of innate immune response; response to hypoxia; ephrin receptor signaling pathway; angiogenesis; embryo implantation

Disease: Multicentric Osteolysis, Nodulosis, And Arthropathy

Research Articles on MMP-2

Similar Products

Product Notes

The MMP-2 mmp2 (Catalog #AAA9140270) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: APSPIIKFPG DVAPKTDKEL AVQYLNTFYG CPKESCNLFV LKDTLKKMQK FFGLPQTGDL DQNTIETMRK PRCGNPDVAN YNFFPRKPKW DKNQITYRII GYTPDLDPET VDDAFARAFQ VWSDVTPLRF SRIHDGEADI MINFGRWEHG DGYPFDGKDG LLAHAFAPGT GVGGDSHFDD DELWTLGEGQ VVRVKYGNAD GEYCKFPFLF NGKEYNSCTD TGRSDGFLWC STTYNFEKDG KYGFCPHEAL FTMGG. It is sometimes possible for the material contained within the vial of "MMP-2/72 kDa type IV collagenase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.