Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

M-phase inducer phosphatase 3 (CDC25C) Recombinant Protein | CDC25C recombinant protein

Recombinant Human M-phase inducer phosphatase 3 (CDC25C)

Gene Names
CDC25C; CDC25; PPP1R60
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
M-phase inducer phosphatase 3 (CDC25C); Recombinant Human M-phase inducer phosphatase 3 (CDC25C); M-phase inducer phosphatase 3; EC=3.1.3.48; Dual specificity phosphatase Cdc25C; CDC25C recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-473aa; Full Length
Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Sequence Length
472
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for CDC25C recombinant protein
Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.
Product Categories/Family for CDC25C recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
995
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57.4 kDa
NCBI Official Full Name
M-phase inducer phosphatase 3 isoform a
NCBI Official Synonym Full Names
cell division cycle 25C
NCBI Official Symbol
CDC25C
NCBI Official Synonym Symbols
CDC25; PPP1R60
NCBI Protein Information
M-phase inducer phosphatase 3; mitosis inducer CDC25; phosphotyrosine phosphatase; dual specificity phosphatase CDC25C; protein phosphatase 1, regulatory subunit 60
UniProt Protein Name
M-phase inducer phosphatase 3
UniProt Gene Name
CDC25C
UniProt Entry Name
MPIP3_HUMAN

NCBI Description

This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known. [provided by RefSeq, Jul 2008]

Uniprot Description

CDC25C: a member of the MPI phosphatase family. Activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. Shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. At least four transcript variants for this gene exist. Three splice variant isoforms have been described.

Protein type: Motility/polarity/chemotaxis; EC 3.1.3.48; Protein phosphatase, dual-specificity

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; perinuclear region of cytoplasm; nucleus; cytosol

Molecular Function: protein binding; WW domain binding; protein tyrosine phosphatase activity; protein kinase binding

Biological Process: mitosis; cell proliferation; viral reproduction; regulation of cell cycle; cell division; regulation of mitosis; spermatogenesis; regulation of cyclin-dependent protein kinase activity; mitotic cell cycle; G2/M transition of mitotic cell cycle; DNA replication

Research Articles on CDC25C

Similar Products

Product Notes

The CDC25C cdc25c (Catalog #AAA717938) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-473aa; Full Length. The amino acid sequence is listed below: MSTELFSSTR EEGSSGSGPS FRSNQRKMLN LLLERDTSFT VCPDVPRTPV GKFLGDSANL SILSGGTPKR CLDLSNLSSG EITATQLTTS ADLDETGHLD SSGLQEVHLA GMNHDQHLMK CSPAQLLCST PNGLDRGHRK RDAMCSSSAN KENDNGNLVD SEMKYLGSPI TTVPKLDKNP NLGEDQAEEI SDELMEFSLK DQEAKVSRSG LYRSPSMPEN LNRPRLKQVE KFKDNTIPDK VKKKYFSGQG KLRKGLCLKK TVSLCDITIT QMLEEDSNQG HLIGDFSKVC ALPTVSGKHQ DLKYVNPETV AALLSGKFQG LIEKFYVIDC RYPYEYLGGH IQGALNLYSQ EELFNFFLKK PIVPLDTQKR IIIVFHCEFS SERGPRMCRC LREEDRSLNQ YPALYYPELY ILKGGYRDFF PEYMELCEPQ SYCPMHHQDH KTELLRCRSQ SKVQEGERQL REQIALLVKD MSP. It is sometimes possible for the material contained within the vial of "M-phase inducer phosphatase 3 (CDC25C), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.