Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD97 antigen (CD97) Recombinant Protein | CD97 recombinant protein

Recombinant Human CD97 antigen (CD97)

Gene Names
ADGRE5; CD97; TM7LN1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD97 antigen (CD97); Recombinant Human CD97 antigen (CD97); CD97 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
531-835aa; Full length protein
Sequence
SSFAILMAHYDVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICL FVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGL STRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVI FVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYV FTILNCLQGAFLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRA SESGI
Sequence Length
835
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CD97 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
976
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,628 Da
NCBI Official Full Name
CD97 antigen isoform 3 preproprotein
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor E5
NCBI Official Symbol
ADGRE5
NCBI Official Synonym Symbols
CD97; TM7LN1
NCBI Protein Information
CD97 antigen
UniProt Protein Name
CD97 antigen
Protein Family
UniProt Gene Name
CD97
UniProt Entry Name
CD97_HUMAN

NCBI Description

This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19. [provided by RefSeq, Jun 2011]

Uniprot Description

CD97: Receptor potentially involved in both adhesion and signaling processes early after leukocyte activation. Plays an essential role in leukocyte migration. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 2; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19p13.12

Cellular Component: extracellular space; focal adhesion; integral to plasma membrane; membrane; plasma membrane

Molecular Function: calcium ion binding; G-protein coupled receptor activity; protein binding; transmembrane receptor activity

Biological Process: cell adhesion; cell motility; cell surface receptor linked signal transduction; cell-cell signaling; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response

Research Articles on CD97

Similar Products

Product Notes

The CD97 cd97 (Catalog #AAA7011198) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 531-835aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CD97 cd97 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SSFAILMAHY DVEDWKLTLI TRVGLALSLF CLLLCILTFL LVRPIQGSRT TIHLHLCICL FVGSTIFLAG IENEGGQVGL RCRLVAGLLH YCFLAAFCWM SLEGLELYFL VVRVFQGQGL STRWLCLIGY GVPLLIVGVS AAIYSKGYGR PRYCWLDFEQ GFLWSFLGPV TFIILCNAVI FVTTVWKLTQ KFSEINPDMK KLKKARALTI TAIAQLFLLG CTWVFGLFIF DDRSLVLTYV FTILNCLQGA FLYLLHCLLN KKVREEYRKW ACLVAGGSKY SEFTSTTSGT GHNQTRALRA SESGI. It is sometimes possible for the material contained within the vial of "CD97 antigen (CD97), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.