Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

39S ribosomal protein L42 Recombinant Protein | MRPL42 recombinant protein

Recombinant Human 39S ribosomal protein L42, mitochondrial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
39S ribosomal protein L42; Recombinant Human 39S ribosomal protein L42; mitochondrial; 28S ribosomal protein S32; MRP-S32; S32mt; 39S ribosomal protein L31; L31mt; MRP-L31; MRPL42 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
33-142aa; Full Length
Sequence
KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
Sequence Length
142
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Product Categories/Family for MRPL42 recombinant protein
References
Mao Y.F., Peng Y., Dai M., Huang Q.H., Song H., Zhang Q.H., Mao M., Fu G., Luo M., Chen J.H., Hu R. Isolating a new human cDNA.Chen J.H., Luo W.Q., Hu S.N., Li G.T., Jin J., Huang X.W., Zhou H.J., Yuan J.G., Qiang B.Q.Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X., Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40.1 kDa
NCBI Official Full Name
39S ribosomal protein L42, mitochondrial
UniProt Protein Name
39S ribosomal protein L42, mitochondrial
Protein Family
UniProt Gene Name
MRPL42
UniProt Synonym Gene Names
MRPL31; MRPS32; RPML31; L42mt; MRP-L42; MRP-S32; S32mt; L31mt; MRP-L31
UniProt Entry Name
RM42_HUMAN

NCBI Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein identified as belonging to both the 28S and the 39S subunits. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 4q, 6p, 6q, 7p, and 15q. [provided by RefSeq, May 2011]

Uniprot Description

MRPL42: Component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins. Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins.

Protein type: Ribosomal; Mitochondrial

Chromosomal Location of Human Ortholog: 12q22

Cellular Component: mitochondrial inner membrane; mitochondrial small ribosomal subunit; mitochondrion; plasma membrane

Molecular Function: structural constituent of ribosome

Biological Process: mitochondrial translation; organelle organization and biogenesis; translation

Research Articles on MRPL42

Similar Products

Product Notes

The MRPL42 mrpl42 (Catalog #AAA969572) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-142aa; Full Length. The amino acid sequence is listed below: KSTYSPLPDD YNCNVELALT SDGRTIVCYH PSVDIPYEHT KPIPRPDPVH NNEETHDQVL KTRLEEKVEH LEEGPMIEQL SKMFFTTKHR WYPHGRYHRC RKNLNPPKDR. It is sometimes possible for the material contained within the vial of "39S ribosomal protein L42, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.