Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

CD83 recombinant protein

Recombinant Human CD83 Protein

Gene Names
CD83; BL11; HB15
Purity
>95% by SDS-PAGE.
Synonyms
CD83; Recombinant Human CD83 Protein; BL11; HB15; CD83 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA
Sequence Length
204
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CD83 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18-25 kDa.)

Related Product Information for CD83 recombinant protein
Description: Recombinant Human CD83 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr20-Ala143) of human CD83 (Accession #NP_004224.1) fused with a 6xHis tag at the C-terminus.

Background: Human CD83 is a 40 - 50 kDa member of the Siglec (or sialic-acid-binding immunoglobulin-like lectin) family of transmembrane proteins. CD83 is considered as a marker of mature dendritic cells as well as an adhesion receptor that binds to resting monocytes and a subset of activated CD8+ T cells. In certain conditions, CD83 tended to dimerize or even multimerize through its aberrant intermolecular disulfide bonds. The injection of CD83-Ig can significantly enhaunce the rate of tumor growth and inhibit the T cell growth.
Product Categories/Family for CD83 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
CD83 antigen isoform b
NCBI Official Synonym Full Names
CD83 molecule
NCBI Official Symbol
CD83
NCBI Official Synonym Symbols
BL11; HB15
NCBI Protein Information
CD83 antigen
UniProt Protein Name
CD83 antigen
Protein Family
UniProt Gene Name
CD83
UniProt Synonym Gene Names
hCD83
UniProt Entry Name
CD83_HUMAN

NCBI Description

The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

CD83: May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p23

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Biological Process: negative regulation of interleukin-4 production; positive regulation of interleukin-2 production; defense response; positive regulation of CD4-positive, alpha beta T cell differentiation; signal transduction; response to organic cyclic substance; positive regulation of interleukin-10 production; humoral immune response

Research Articles on CD83

Similar Products

Product Notes

The CD83 cd83 (Catalog #AAA9141845) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TPEVKVACSE DVDLPCTAPW DPQVPYTVSW VKLLEGGEER METPQEDHLR GQHYHQKGQN GSFDAPNERP YSLKIRNTTS CNSGTYRCTL QDPDGQRNLS GKVILRVTGC PAQRKEETFK KYRA. It is sometimes possible for the material contained within the vial of "CD83, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual