CD83 recombinant protein

Recombinant Human CD83 Protein

Cat. Num. AAA9141845

• Gene Names: CD83; BL11; HB15
• Purity: >95% by SDS-PAGE.
• Synonyms: CD83; Recombinant Human CD83 Protein; BL11; HB15; CD83 recombinant protein

• Host: HEK293 Cells
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA
• Sequence Length: 204

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CD83 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18-25 kDa.)

Related Product Information for CD83 recombinant protein

Description: Recombinant Human CD83 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr20-Ala143) of human CD83 (Accession #NP_004224.1) fused with a 6xHis tag at the C-terminus.

Background: Human CD83 is a 40 - 50 kDa member of the Siglec (or sialic-acid-binding immunoglobulin-like lectin) family of transmembrane proteins. CD83 is considered as a marker of mature dendritic cells as well as an adhesion receptor that binds to resting monocytes and a subset of activated CD8+ T cells. In certain conditions, CD83 tended to dimerize or even multimerize through its aberrant intermolecular disulfide bonds. The injection of CD83-Ig can significantly enhaunce the rate of tumor growth and inhibit the T cell growth.

Product Categories/Family for CD83 recombinant protein

CD Antigen

NCBI and Uniprot Product Information

• NCBI GI #: 94421024
• NCBI GeneID: 9308
• NCBI Accession #: NP_001035370.1
• NCBI GenBank Nucleotide #: NP_001035370.1
• UniProt Accession #: Q01151
• NCBI Official Full Name: CD83 antigen isoform b
• NCBI Official Synonym Full Names: CD83 molecule
• NCBI Official Symbol: CD83
• NCBI Official Synonym Symbols: BL11; HB15
• NCBI Protein Information: CD83 antigen
• UniProt Protein Name: CD83 antigen
• Protein Family: CD83 antigen
• UniProt Gene Name: CD83
• UniProt Synonym Gene Names: hCD83
• UniProt Entry Name: CD83_HUMAN

NCBI Description

The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

CD83: May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p23

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Biological Process: negative regulation of interleukin-4 production; positive regulation of interleukin-2 production; defense response; positive regulation of CD4-positive, alpha beta T cell differentiation; signal transduction; response to organic cyclic substance; positive regulation of interleukin-10 production; humoral immune response