Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of IL22RA1 expression in transfected 293T cell line by IL22RA1 monoclonal antibody (M01), clone 2E6.Lane 1: IL22RA1 transfected lysate (Predicted MW: 63.1 KDa).Lane 2: Non-transfected lysate.)

Mouse IL22RA1 Monoclonal Antibody | anti-IL22RA1 antibody

IL22RA1 (Interleukin 22 Receptor, alpha 1, CRF2-9, IL22R, IL22R1) (Biotin)

Gene Names
IL22RA1; IL22R; CRF2-9; IL22R1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
IL22RA1; Monoclonal Antibody; IL22RA1 (Interleukin 22 Receptor; alpha 1; CRF2-9; IL22R; IL22R1) (Biotin); Interleukin 22 Receptor; IL22R1; anti-IL22RA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2000000
Specificity
Recognizes IL22RA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-IL22RA1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IL22RA1 (NP_067081, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IL22RA1 expression in transfected 293T cell line by IL22RA1 monoclonal antibody (M01), clone 2E6.Lane 1: IL22RA1 transfected lysate (Predicted MW: 63.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IL22RA1 expression in transfected 293T cell line by IL22RA1 monoclonal antibody (M01), clone 2E6.Lane 1: IL22RA1 transfected lysate (Predicted MW: 63.1 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-IL22RA1 antibody
The protein encoded by this gene belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shared by the receptor complex for interleukin 10 (IL10). This gene and interleukin 28 receptor, alpha (IL28RA) form a cytokine receptor gene cluster in the chromosomal region 1p36. [provided by RefSeq]
Product Categories/Family for anti-IL22RA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Predicted: 63 kDa

Observed: 62 kDa
NCBI Official Full Name
Homo sapiens IL-22 receptor (IL22R) mRNA, complete cds
NCBI Official Synonym Full Names
interleukin 22 receptor, alpha 1
NCBI Official Symbol
IL22RA1
NCBI Official Synonym Symbols
IL22R; CRF2-9; IL22R1
NCBI Protein Information
interleukin-22 receptor subunit alpha-1; IL-22RA1; zcytoR11; IL-22R-alpha-1; IL-22 receptor subunit alpha-1; cytokine receptor class-II member 9; cytokine receptor family 2 member 9
UniProt Protein Name
Interleukin-22 receptor subunit alpha-1
Protein Family
UniProt Gene Name
IL22RA1
UniProt Synonym Gene Names
IL22R; IL-22 receptor subunit alpha-1; IL-22R-alpha-1; IL-22RA1; CRF2-9
UniProt Entry Name
I22R1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shared by the receptor complex for interleukin 10 (IL10). This gene and interleukin 28 receptor, alpha (IL28RA) form a cytokine receptor gene cluster in the chromosomal region 1p36. [provided by RefSeq, Jul 2008]

Uniprot Description

IL22RA1: Component of the receptor for IL20, IL22 and IL24. Component of IL22 receptor formed by IL22RA1 and IL10RB enabling IL22 signaling via JAK/STAT pathways. IL22 also induces activation of MAPK1/MAPK3 and Akt kinases pathways. Component of one of the receptor for IL20 and IL24 formed by IL22RA1 and IL20RB also signaling through STATs activation. Mediates IL24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation. Belongs to the type II cytokine receptor family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: integral to membrane; plasma membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; interferon receptor activity; interleukin-20 binding

Biological Process: cytokine and chemokine mediated signaling pathway; defense response to Gram-negative bacterium

Research Articles on IL22RA1

Similar Products

Product Notes

The IL22RA1 il22ra1 (Catalog #AAA6170746) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IL22RA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL22RA1 il22ra1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL22RA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.