CD63 antigen (CD63) Recombinant Protein | CD63 recombinant protein

Recombinant Human CD63 antigen (CD63), partial

Cat. Num. AAA968215

• Gene Names: CD63; MLA1; ME491; LAMP-3; OMA81H; TSPAN30
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: CD63 antigen (CD63); Recombinant Human CD63 antigen (CD63); partial; CD63 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 103-203aa; Partial
• Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

NCBI and Uniprot Product Information

• NCBI GI #: 383872447
• NCBI GeneID: 967
• NCBI Accession #: NP_001244318.1
• NCBI GenBank Nucleotide #: NM_001257389.1
• UniProt Accession #: P08962; Q5TZP3; Q8N6Z9; Q9UCG6; F8VZE2
• Molecular Weight: 13.5 kDa
• NCBI Official Full Name: CD63 antigen isoform A
• NCBI Official Synonym Full Names: CD63 molecule
• NCBI Official Symbol: CD63
• NCBI Official Synonym Symbols: MLA1; ME491; LAMP-3; OMA81H; TSPAN30
• NCBI Protein Information: CD63 antigen
• UniProt Protein Name: CD63 antigen
• Protein Family: CD63 antigen
• UniProt Gene Name: CD63
• UniProt Synonym Gene Names: MLA1; TSPAN30; LAMP-3; Tspan-30

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012]

Uniprot Description

Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.