Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lymphocyte function-associated antigen 3 Recombinant Protein | CD58 recombinant protein

Lymphocyte function-associated antigen 3

Gene Names
CD58; ag3; LFA3; LFA-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lymphocyte function-associated antigen 3; CD58 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
29-250aa; full length protein
Sequence
FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
Sequence Length
Full Length Protein
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CD58 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for CD58 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
965
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,960 Da
NCBI Official Full Name
lymphocyte function-associated antigen 3 isoform 2
NCBI Official Synonym Full Names
CD58 molecule
NCBI Official Symbol
CD58
NCBI Official Synonym Symbols
ag3; LFA3; LFA-3
NCBI Protein Information
lymphocyte function-associated antigen 3
UniProt Protein Name
Lymphocyte function-associated antigen 3
UniProt Gene Name
CD58
UniProt Synonym Gene Names
LFA3; Ag3
UniProt Entry Name
LFA3_HUMAN

NCBI Description

This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]

Uniprot Description

CD58: Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen- presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p13

Cellular Component: cell surface; membrane; plasma membrane

Molecular Function: protein binding; receptor binding

Biological Process: heterotypic cell-cell adhesion; leukocyte migration

Research Articles on CD58

Similar Products

Product Notes

The CD58 cd58 (Catalog #AAA7042472) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-250aa; full length protein. The amino acid sequence is listed below: FSQQIYGVVY GNVTFHVPSN VPLKEVLWKK QKDKVAELEN SEFRAFSSFK NRVYLDTVSG SLTIYNLTSS DEDEYEMESP NITDTMKFFL YVLESLPSPT LTCALTNGSI EVQCMIPEHY NSHRGLIMYS WDCPMEQCKR NSTSIYFKME NDLPQKIQCT LSNPLFNTTS SIILTTCIPS SGHSRHRYAL IPIPLAVITT CIVLYMNGIL KCDRKPDRTN SN. It is sometimes possible for the material contained within the vial of "Lymphocyte function-associated antigen 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.