Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

T-cell surface glycoprotein CD5 Recombinant Protein | CD5 recombinant protein

T-cell surface glycoprotein CD5

Gene Names
CD5; T1; LEU1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
T-cell surface glycoprotein CD5; CD5 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
25-495aa; full length protein
Sequence
RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Sequence Length
Full Length Protein
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CD5 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for CD5 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
921
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,578 Da
NCBI Official Full Name
T-cell surface glycoprotein CD5
NCBI Official Synonym Full Names
CD5 molecule
NCBI Official Symbol
CD5
NCBI Official Synonym Symbols
T1; LEU1
NCBI Protein Information
T-cell surface glycoprotein CD5
UniProt Protein Name
T-cell surface glycoprotein CD5
UniProt Gene Name
CD5
UniProt Synonym Gene Names
LEU1
UniProt Entry Name
CD5_HUMAN

Uniprot Description

CD5: a surface glycoprotein expressed on T cells and B-1 B cells. Rapidly recruited to the immunological synapse, lowering the response of the T cell antigen receptor. CD5 interacts with CD72/LYB-2. Promotes B-cell survival through stimulation of autocrine IL-10 production. Contains 3 SRCR domains.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: plasma membrane

Molecular Function: protein binding

Research Articles on CD5

Similar Products

Product Notes

The CD5 cd5 (Catalog #AAA7042469) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-495aa; full length protein. The amino acid sequence is listed below: RLSWYDPDFQ ARLTRSNSKC QGQLEVYLKD GWHMVCSQSW GRSSKQWEDP SQASKVCQRL NCGVPLSLGP FLVTYTPQSS IICYGQLGSF SNCSHSRNDM CHSLGLTCLE PQKTTPPTTR PPPTTTPEPT APPRLQLVAQ SGGQHCAGVV EFYSGSLGGT ISYEAQDKTQ DLENFLCNNL QCGSFLKHLP ETEAGRAQDP GEPREHQPLP IQWKIQNSSC TSLEHCFRKI KPQKSGRVLA LLCSGFQPKV QSRLVGGSSI CEGTVEVRQG AQWAALCDSS SARSSLRWEE VCREQQCGSV NSYRVLDAGD PTSRGLFCPH QKLSQCHELW ERNSYCKKVF VTCQDPNPAG LAAGTVASII LALVLLVVLL VVCGPLAYKK LVKKFRQKKQ RQWIGPTGMN QNMSFHRNHT ATVRSHAENP TASHVDNEYS QPPRNSHLSA YPALEGALHR SSMQPDNSSD SDYDLHGAQR L. It is sometimes possible for the material contained within the vial of "T-cell surface glycoprotein CD5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.