Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Membrane cofactor protein Recombinant Protein | Cd46 recombinant protein

Recombinant Mouse Membrane cofactor protein

Gene Names
Cd46; Mcp
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Membrane cofactor protein; Recombinant Mouse Membrane cofactor protein; CD46; Cd46 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
45-329aa; Extracellular Domain
Sequence
CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAW
Sequence Length
365
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Cd46 recombinant protein
May be involved in the fusion of the spermatozoa with the oocyte during fertilization.
References
Molecular cloning of a murine homologue of membrane cofactor protein (CD46) preferential expression in testicular germ cells.Tsujimura A., Shida K., Kitamura M., Nomura M., Takeda J., Tanaka H., Matsumoto M., Matsumiya K., Okuyama A., Nishimune Y., Okabe M., Seya T.Biochem. J. 330:163-168(1998) Molecular cloning of rat and mouse membrane cofactor protein (MCP, CD46) preferential expression in testis and close linkage between the mouse Mcp and Cr2 genes on distal chromosome 1.Miwa T., Nonaka M., Okada N., Wakana S., Shiroishi T., Okada H.Immunogenetics 48:363-371(1998) Membrane and secretory forms of mouse membrane cofactor protein (CD46) generated from a single gene through alternative splicing.Nomura M., Tsujimura A., Shida K., Matsumoto M., Matsuda Y., Toyoshima K., Seya T.Immunogenetics 50:245-254(1999) Disruption of mouse CD46 causes an accelerated spontaneous acrosome reaction in sperm.Inoue N., Ikawa M., Nakanishi T., Matsumoto M., Nomura M., Seya T., Okabe M.Mol. Cell. Biol. 23:2614-2622(2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.9 kDa
NCBI Official Full Name
membrane cofactor protein
NCBI Official Synonym Full Names
CD46 antigen, complement regulatory protein
NCBI Official Symbol
Cd46
NCBI Official Synonym Symbols
Mcp
NCBI Protein Information
membrane cofactor protein
UniProt Protein Name
Membrane cofactor protein
Protein Family
UniProt Gene Name
Cd46
UniProt Synonym Gene Names
Mcp
UniProt Entry Name
MCP_MOUSE

Uniprot Description

CD46: Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement- mediated injury by cleaving C3b and C4b deposited on host tissue. May be involved in the fusion of the spermatozoa with the oocyte during fertilization. Also acts as a costimulatory factor for T- cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity. A number of viral and bacterial pathogens seem to exploit this property and directly induce an immunosuppressive phenotype in T-cells by binding to CD46. Defects in CD46 are a cause of susceptibility to hemolytic uremic syndrome atypical type 2 (AHUS2). An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype. Patients with CD46 mutations seem to have an overall better prognosis compared to patients carrying CFH mutations. 16 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Receptor, misc.; Membrane protein, integral

Cellular Component: acrosome; basolateral plasma membrane; cell surface; cytoplasm; cytoplasmic vesicle; extracellular region; focal adhesion; Golgi apparatus; inner acrosomal membrane; integral to membrane; membrane; plasma membrane

Molecular Function: cadherin binding; complement binding; endopeptidase activity; enzyme inhibitor activity

Biological Process: interleukin-10 production; negative regulation of catalytic activity; negative regulation of complement activation; positive regulation of interleukin-10 production; positive regulation of memory T cell differentiation; positive regulation of regulatory T cell differentiation; positive regulation of T cell proliferation; proteolysis; regulation of Notch signaling pathway; single fertilization; T cell mediated immunity

Research Articles on Cd46

Similar Products

Product Notes

The Cd46 cd46 (Catalog #AAA1111488) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 45-329aa; Extracellular Domain. The amino acid sequence is listed below: CELPRPFEAM ELKGTPKLFY AVGEKIEYKC KKGYLYLSPY LMIATCEPNH TWVPISDAGC IKVQCTMLQD PSFGKVYYID GSFSWGARAK FTCMEGYYVV GMSVLHCVLK GDDEAYWNGY PPHCEKIYCL PPPKIKNGTH TLTDINVFKY HEAVSYSCDP TPGPDKFSLV GTSMIFCAGH NTWSNSPPEC KVVKCPNPVL QNGRLISGAG EIFSYQSTVM FECLQGFYME GSSMVICSAN NSWEPSIPKC LKGPRPTHPT KPPVYNYTGY PSPREGIFSQ ELDAW. It is sometimes possible for the material contained within the vial of "Membrane cofactor protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.