SDS-Page
(Recombinant Human CD300C Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38-45 kDa.)
CD300C recombinant protein
Recombinant Human CD300C Protein
Gene Names
CD300C; LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1
Purity
>95% by SDS-PAGE.
Synonyms
CD300C; Recombinant Human CD300C Protein; CLM-6; CMRF-35; CMRF-35A; CMRF35; CMRF35-A1; CMRF35A; CMRF35A1; IGSF16; LIR; CD300C recombinant protein
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Sequence Length
224
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human CD300C Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38-45 kDa.)
SDS-Page
(Recombinant Human CD300C Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38-45 kDa.)
Related Product Information for CD300C recombinant protein
Description: Recombinant Human CD300C Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly 21 - Arg 183) of human CD300C (Accession #NP_006669.1) fused with a 6xHis tag at the C-terminus.
Background: The recombinant human CD300C consists of 166 amino acids with a molecular weight of 18.4 kDa. The apparent molecular mass of recombinant human CD300C is about 40-45 kDa in SDS-PAGE under reducing conditions due to glycosylation.The cluster of differentiation (CD) system is commonly used as cell markers in immunophynotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. CD300C is present on the surface of natural killer cells, granulocytes, most myeloid cells, dendritic cells, and a subpopulation of T and B lymphocytes. Mouse CD300C has the characteristics of an activatory molecule capable of inducing cellular activation and effector function in most cells and macrophages. The ligand for CD300C is presently unknown.
Background: The recombinant human CD300C consists of 166 amino acids with a molecular weight of 18.4 kDa. The apparent molecular mass of recombinant human CD300C is about 40-45 kDa in SDS-PAGE under reducing conditions due to glycosylation.The cluster of differentiation (CD) system is commonly used as cell markers in immunophynotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. CD300C is present on the surface of natural killer cells, granulocytes, most myeloid cells, dendritic cells, and a subpopulation of T and B lymphocytes. Mouse CD300C has the characteristics of an activatory molecule capable of inducing cellular activation and effector function in most cells and macrophages. The ligand for CD300C is presently unknown.
Product Categories/Family for CD300C recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
CMRF35-like molecule 6
NCBI Official Synonym Full Names
CD300c molecule
NCBI Official Symbol
CD300C
NCBI Official Synonym Symbols
LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1
NCBI Protein Information
CMRF35-like molecule 6
UniProt Protein Name
CMRF35-like molecule 6
Protein Family
UniProt Gene Name
CD300C
UniProt Synonym Gene Names
CMRF35; CMRF35A; CMRF35A1; IGSF16; CLM-6; CMRF-35; IgSF16
UniProt Entry Name
CLM6_HUMAN
NCBI Description
The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM, Mar 2008]
Uniprot Description
CD300C: Belongs to the CD300 family
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 17q25.1
Cellular Component: integral to plasma membrane
Molecular Function: transmembrane receptor activity
Biological Process: immune system process; cellular defense response; signal transduction
Research Articles on CD300C
Similar Products
Product Notes
The CD300C cd300c (Catalog #AAA9141814) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GYFPLSHPMT VAGPVGGSLS VQCRYEKEHR TLNKFWCRPP QILRCDKIVE TKGSAGKRNG RVSIRDSPAN LSFTVTLENL TEEDAGTYWC GVDTPWLRDF HDPIVEVEVS VFPAGTTTAS SPQSSMGTSG PPTKLPVHTW PSVTRKDSPE PSPHPGSLFS NVR. It is sometimes possible for the material contained within the vial of "CD300C, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
