T-cell-specific surface glycoprotein CD28 Recombinant Protein | CD28 recombinant protein

T-cell-specific surface glycoprotein CD28

Cat. Num. AAA7042414

• Gene Names: CD28; Tp44
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: T-cell-specific surface glycoprotein CD28; CD28 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 19-220aa; Full Length of Mature Protein
• Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CD28 recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for CD28 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 340545508
• NCBI GeneID: 940
• NCBI Accession #: NP_001230006.1
• NCBI GenBank Nucleotide #: NM_001243077.1
• UniProt Accession #: P10747; Q13964; Q52M23; Q70WG0; Q8NI54; Q8NI55; Q8NI56; Q8WXJ2; Q9BYV0; A8KAC1
• Molecular Weight: 26,186 Da
• NCBI Official Full Name: T-cell-specific surface glycoprotein CD28 isoform 2
• NCBI Official Synonym Full Names: CD28 molecule
• NCBI Official Symbol: CD28
• NCBI Official Synonym Symbols: Tp44
• NCBI Protein Information: T-cell-specific surface glycoprotein CD28
• UniProt Protein Name: T-cell-specific surface glycoprotein CD28
• Protein Family: T-cell-specific surface glycoprotein
• UniProt Gene Name: CD28
• UniProt Entry Name: CD28_HUMAN

NCBI Description

The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]

Uniprot Description

CD28: a type I plasma membrane protein Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Binds to B7-1 and -2. Expressed in T cells and plasma cells, but not in less mature B cells. Six splice-variant isoforms have been described.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 2q33

Cellular Component: cell surface; cytosol; external side of plasma membrane; integral to plasma membrane; plasma membrane

Molecular Function: coreceptor activity; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; protease binding; protein binding; SH3/SH2 adaptor activity

Biological Process: cell surface receptor linked signal transduction; cytokine biosynthetic process; humoral immune response; phosphoinositide-mediated signaling; positive regulation of interleukin-10 production; positive regulation of interleukin-2 biosynthetic process; positive regulation of interleukin-4 production; positive regulation of mitosis; positive regulation of T cell proliferation; regulation of defense response to virus by virus; regulation of phosphoinositide 3-kinase cascade; regulatory T cell differentiation; T cell costimulation