Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD3Z recombinant protein

CD3Z Recombinant Protein

Gene Names
CD247; T3Z; CD3H; CD3Q; CD3Z; TCRZ; CD3-ZETA
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD3Z; CD3Z Recombinant Protein; CD3Z recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
351
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD3Z recombinant protein
Background: When T cells encounter antigens via the T cell receptor (TCR), information about the quantity and quality of antigens is relayed to the intracellular signal transduction machinery. This activation process depends mainly on CD3 (Cluster of Differentiation 3), a multiunit protein complex that directly associates with the TCR. CD3 is composed of four polypeptides: zeta, gamma, epsilon and delta. Each of these polypeptides contains at least one immunoreceptor tyrosine-based activation motif (ITAM). Engagement of TCR complex with foreign antigens induces tyrosine phosphorylation in the ITAM motifs and phosphorylated ITAMs function as docking sites for signaling molecules such as ZAP-70 and p85 subunit of PI-3 kinase. TCR ligation also induces a conformational change in CD3epsilon, such that a proline region is exposed and then associates with the adaptor protein Nck. The CD3zeta invariant chain is a type-I transmembrane protein that exists in the TCR signaling complex as a disulfide-linked homodimer. The cytoplasmic tail of each CD3zeta monomer contains three distinct ITAM motifs, each containing two tyrosine residues. Phosphorylation of CD3zeta ITAM tyrosine residues, including Y142, is driven by recruitment of the Lck and Fyn tyrosine kinases to the TCR. Lck/Fyn-mediated ITAM phosphorylation creates docking sites that promote the SH2 domain-dependent recruitment and activation of ZAP-70, which drives amplification of signaling events downstream of the TCR that facilitate T cell activation. Phosphorylation of a pool of p16 CD3zeta leads to the generation of p21 and p23 species, which differ in the degree of ITAM phosphorylation. It has been proposed that the ratio of p21/p23 contributes to regulating the amplitude of T cell activation. CD3zeta plays an important role in the assembly and surface expression of the TCR complex. Indeed, research studies have demonstrated that CD3zeta is degraded in response to Ag-dependent TCR stimulation as a mechanism to tightly control T cell activation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
919
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,696 Da
NCBI Official Full Name
T-cell surface glycoprotein CD3 zeta chain isoform 2
NCBI Official Synonym Full Names
CD247 molecule
NCBI Official Symbol
CD247
NCBI Official Synonym Symbols
T3Z; CD3H; CD3Q; CD3Z; TCRZ; CD3-ZETA
NCBI Protein Information
T-cell surface glycoprotein CD3 zeta chain; CD3zeta chain; TCR zeta chain; CD247 antigen, zeta subunit; T-cell receptor T3 zeta chain; CD3Z antigen, zeta polypeptide (TiT3 complex); T-cell antigen receptor complex, zeta subunit of CD3
UniProt Protein Name
T-cell surface glycoprotein CD3 zeta chain
UniProt Gene Name
CD247
UniProt Synonym Gene Names
CD3Z; T3Z; TCRZ
UniProt Entry Name
CD3Z_HUMAN

NCBI Description

The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CD3Z: a T cell surface glycoprotein that is a component of the T cell antigen receptor. Plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the CD3-epsilon results in impaired immune response. Two alternatively spliced isoforms have been described.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: T cell receptor complex; cytoplasm; plasma membrane; integral to membrane; alpha-beta T cell receptor complex

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; transmembrane receptor activity

Biological Process: regulation of immune response; viral reproduction; T cell costimulation; innate immune response; T cell receptor signaling pathway; regulation of defense response to virus by virus

Disease: Immunodeficiency 25

Research Articles on CD3Z

Similar Products

Product Notes

The CD3Z cd247 (Catalog #AAA3003611) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RVKFSRSADA PAYQQGQNQL YNELNLGRRE EYDVLDKRRG RDPEMGGKPQ RRKNPQEGLY NELQKDKMAE AYSEIGMKGE RRRGKGHDGL YQGLSTATKD TYDALHMQAL PPR. It is sometimes possible for the material contained within the vial of "CD3Z, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.