CD22 recombinant protein

CD22 Recombinant Protein

Cat. Num. AAA3003530

• Gene Names: CD22; SIGLEC2; SIGLEC-2
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD22; CD22 Recombinant Protein; CD22 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 2016
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD22 recombinant protein

Background: CD22 (also known as siglec-2) is a member of the sialic acid-binding immunoglobulin-type lectin (Siglec) family of immunomodulatory receptors. CD22 can bind to its ligand alpha 2,6-linked sialic acid on different cells (trans interaction) as well as on the same cells (cis interaction). CD22 is predominantly expressed on B cells and functions as an inhibitory co-receptor for the B cell receptor (BCR). After BCR ligation, the tyrosine kinase Lyn is activated and phosphorylates two distal of the four ITIM motifs in the intracellular carboxy-terminal region of CD22, which then recruit tyrosine phosphatases, including SHP-1, to the plasma membrane, and in turn, they get tyrosine-phosphorylated and activated to damp the signaling pathways initiated by BCR ligation. CD22 has been actively pursued as a therapeutic target for autoimmune diseases. Due to almost exclusive expression on B cells, it is also actively pursued as a therapeutic target for multiple B cell malignancies.

NCBI and Uniprot Product Information

• NCBI GI #: 297374825
• NCBI GeneID: 933
• NCBI Accession #: NP_001172028.1
• NCBI GenBank Nucleotide #: NM_001185099.1
• UniProt Accession #: P20273; O95699; O95701; O95702; O95703; Q01665; Q92872; Q92873; Q9UQA6; Q9UQA7; Q9UQA8; F5H7U3
• Molecular Weight: 95,348 Da
• NCBI Official Full Name: B-cell receptor CD22 isoform 2
• NCBI Official Synonym Full Names: CD22 molecule
• NCBI Official Symbol: CD22
• NCBI Official Synonym Symbols: SIGLEC2; SIGLEC-2
• NCBI Protein Information: B-cell receptor CD22; BL-CAM; CD22 antigen; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2
• UniProt Protein Name: B-cell receptor CD22
• Protein Family: CD226 antigen
• UniProt Gene Name: CD22
• UniProt Synonym Gene Names: SIGLEC2; BL-CAM; Siglec-2
• UniProt Entry Name: CD22_HUMAN

Uniprot Description

CD22: Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: integral to plasma membrane; external side of plasma membrane

Molecular Function: protein binding; carbohydrate binding

Biological Process: cell adhesion