Antigen-presenting glycoprotein CD1d Recombinant Protein | CD1D recombinant protein

Recombinant Human Antigen-presenting glycoprotein CD1d

Cat. Num. AAA960119

• Gene Names: CD1D; R3; CD1A; R3G1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Antigen-presenting glycoprotein CD1d; Recombinant Human Antigen-presenting glycoprotein CD1d; R3G1; CD1d; CD1D recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-301aa; Extracellular Domain
• Sequence: EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS
• Sequence Length: 335

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CD1D recombinant protein

Antigen-presenting protein that binds self and non-self glycolipids and presents th to T-cell receptors on natural killer T-cells.

Product Categories/Family for CD1D recombinant protein

Immunology

References

Two classes of CD1 genes.Calabi F., Jarvis J.M., Martin L., Milstein C.Eur. J. Immunol. 19:285-292(1989) Isolation and characterization of a cDNA and gene coding for a fourth CD1 molecule.Balk S.P., Bleicher P.A., Terhorst C.Proc. Natl. Acad. Sci. U.S.A. 86:252-256(1989) The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 4502649
• NCBI GeneID: 912
• NCBI Accession #: NP_001757.1
• NCBI GenBank Nucleotide #: NM_001766.3
• UniProt Accession #: P15813; Q5W0J3; Q9UMM3; Q9Y5M4; D3DVD5
• Molecular Weight: 47.9 kDa
• NCBI Official Full Name: antigen-presenting glycoprotein CD1d isoform 1
• NCBI Official Synonym Full Names: CD1d molecule
• NCBI Official Symbol: CD1D
• NCBI Official Synonym Symbols: R3; CD1A; R3G1
• NCBI Protein Information: antigen-presenting glycoprotein CD1d
• UniProt Protein Name: Antigen-presenting glycoprotein CD1d
• Protein Family: Antigen-presenting glycoprotein
• UniProt Gene Name: CD1D
• UniProt Entry Name: CD1D_HUMAN

NCBI Description

This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]

Uniprot Description

CD1D: Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.

Protein type: Cell surface; Membrane protein, integral; Apoptosis; Lipid-binding

Chromosomal Location of Human Ortholog: 1q23.1

Cellular Component: basolateral plasma membrane; cell surface; cytoplasm; endoplasmic reticulum membrane; endosome membrane; integral to plasma membrane; lysosomal membrane

Molecular Function: beta-2-microglobulin binding; cell adhesion molecule binding; endogenous lipid antigen binding; exogenous lipid antigen binding; histone binding; lipid antigen binding; receptor activity

Biological Process: antigen processing and presentation, endogenous lipid antigen via MHC class Ib; antigen processing and presentation, exogenous lipid antigen via MHC class Ib; detection of bacterium; heterotypic cell-cell adhesion; innate immune response; positive regulation of innate immune response; positive regulation of T cell proliferation; T cell selection; viral reproduction