CD177 antigen (CD177) Recombinant Protein | CD177 recombinant protein

Recombinant Human CD177 antigen (CD177)

Cat. Num. AAA1334460

• Gene Names: CD177; NB1; PRV1; HNA2A; PRV-1; HNA-2a; NB1 GP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: CD177 antigen (CD177); Recombinant Human CD177 antigen (CD177); CD177 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 22-408, Full length protein
• Sequence: LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGATHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGG
• Sequence Length: 387

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 110735433
• NCBI GeneID: 57126
• NCBI Accession #: NP_065139.2
• NCBI GenBank Nucleotide #: NM_020406.3
• UniProt Accession #: Q8N6Q3; Q711Q2; Q8NCV9; Q96QH1; Q9HDA5
• Molecular Weight: 15,683 Da
• NCBI Official Full Name: CD177 antigen
• NCBI Official Synonym Full Names: CD177 molecule
• NCBI Official Symbol: CD177
• NCBI Official Synonym Symbols: NB1; PRV1; HNA2A; PRV-1; HNA-2a; NB1 GP
• NCBI Protein Information: CD177 antigen
• UniProt Protein Name: CD177 antigen
• Protein Family: CD177 antigen
• UniProt Gene Name: CD177
• UniProt Synonym Gene Names: PRV-1

NCBI Description

This gene encodes a glycosyl-phosphatidylinositol (GPI)-linked cell surface glycoprotein that plays a role in neutrophil activation. The protein can bind platelet endothelial cell adhesion molecule-1 and function in neutrophil transmigration. Mutations in this gene are associated with myeloproliferative diseases. Over-expression of this gene has been found in patients with polycythemia rubra vera. Autoantibodies against the protein may result in pulmonary transfusion reactions, and it may be involved in Wegener's granulomatosis. A related pseudogene, which is adjacent to this gene on chromosome 19, has been identified. [provided by RefSeq, Apr 2014]

Uniprot Description

In association with beta-2 integrin heterodimer ITGAM/CD11b and ITGB2/CD18, mediates activation of TNF-alpha primed neutrophils including degranulation and superoxide production (PubMed:21193407). In addition, by preventing beta-2 integrin internalization and attenuating chemokine signaling favors adhesion over migration (PubMed:28807980). Heterophilic interaction with PECAM1 on endothelial cells plays a role in neutrophil transendothelial migration in vitro (PubMed:17580308). However, appears to be dispensable for neutrophil recruitment caused by bacterial infection in vivo (PubMed:23461681). Acts as a receptor for the mature form of protease PRTN3 allowing its display at the cell surface of neutrophils (PubMed:17244676, PubMed:18462208). By displaying PRTN3 at the neutrophil cell surface, may play a role in enhancing endothelial cell junctional integrity and thus vascular integrity during neutrophil diapedesis (PubMed:23202369).