Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Monocyte differentiation antigen CD14 Recombinant Protein | CD14 recombinant protein

Recombinant Human Monocyte differentiation antigen CD14

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Monocyte differentiation antigen CD14; Recombinant Human Monocyte differentiation antigen CD14; Myeloid cell-specific leucine-rich glycoprotein; CD14; CD14 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-345aa; Full Length of Mature Protein
Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CD14 recombinant protein
In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the MD-2/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.
Product Categories/Family for CD14 recombinant protein
References
The monocyte differentiation antigen, CD14, is anchored to the cell membrane by a phosphatidylinositol linkage.Haziot A., Chen S., Ferrero E., Low M.G., Silber R., Goyert S.M.J. Immunol. 141:547-552(1988)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
929
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.2 kDa
NCBI Official Full Name
monocyte differentiation antigen CD14
NCBI Official Synonym Full Names
CD14 molecule
NCBI Official Symbol
CD14
NCBI Protein Information
monocyte differentiation antigen CD14
UniProt Protein Name
Monocyte differentiation antigen CD14
UniProt Gene Name
CD14
UniProt Entry Name
CD14_HUMAN

NCBI Description

The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Mar 2010]

Uniprot Description

CD14: Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: anchored to external side of plasma membrane; endosome membrane; extracellular region; extracellular space; Golgi apparatus; lipid raft; lipopolysaccharide receptor complex; plasma membrane

Molecular Function: lipopolysaccharide binding; opsonin receptor activity; peptidoglycan receptor activity; protein binding

Biological Process: apoptosis; cell surface receptor linked signal transduction; I-kappaB kinase/NF-kappaB cascade; inflammatory response; innate immune response; lipopolysaccharide-mediated signaling pathway; MyD88-dependent toll-like receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; phagocytosis; positive regulation of cytokine secretion; positive regulation of endocytosis; positive regulation of interferon type I production; positive regulation of interferon-gamma production; positive regulation of tumor necrosis factor production; programmed cell death; receptor-mediated endocytosis; response to electrical stimulus; response to ethanol; response to heat; response to magnesium ion; toll-like receptor 2 signaling pathway; toll-like receptor 3 signaling pathway; toll-like receptor 4 signaling pathway; toll-like receptor signaling pathway

Research Articles on CD14

Similar Products

Product Notes

The CD14 cd14 (Catalog #AAA718204) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-345aa; Full Length of Mature Protein. The amino acid sequence is listed below: TTPEPCELDD EDFRCVCNFS EPQPDWSEAF QCVSAVEVEI HAGGLNLEPF LKRVDADADP RQYADTVKAL RVRRLTVGAA QVPAQLLVGA LRVLAYSRLK ELTLEDLKIT GTMPPLPLEA TGLALSSLRL RNVSWATGRS WLAELQQWLK PGLKVLSIAQ AHSPAFSCEQ VRAFPALTSL DLSDNPGLGE RGLMAALCPH KFPAIQNLAL RNTGMETPTG VCAALAAAGV QPHSLDLSHN SLRATVNPSA PRCMWSSALN SLNLSFAGLE QVPKGLPAKL RVLDLSCNRL NRAPQPDELP EVDNLTLDGN PFLVPGTALP HEGSMN . It is sometimes possible for the material contained within the vial of "Monocyte differentiation antigen CD14, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.