Monocyte differentiation antigen CD14 Recombinant Protein | CD14 recombinant protein

Recombinant Human Monocyte differentiation antigen CD14

Cat. Num. AAA718204

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Monocyte differentiation antigen CD14; Recombinant Human Monocyte differentiation antigen CD14; Myeloid cell-specific leucine-rich glycoprotein; CD14; CD14 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-345aa; Full Length of Mature Protein
• Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CD14 recombinant protein

In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the MD-2/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.

Product Categories/Family for CD14 recombinant protein

Immunology

References

The monocyte differentiation antigen, CD14, is anchored to the cell membrane by a phosphatidylinositol linkage.Haziot A., Chen S., Ferrero E., Low M.G., Silber R., Goyert S.M.J. Immunol. 141:547-552(1988)

NCBI and Uniprot Product Information

• NCBI GI #: 4557417
• NCBI GeneID: 929
• NCBI Accession #: NP_000582.1
• NCBI GenBank Nucleotide #: NM_000591.3
• UniProt Accession #: P08571; Q53XT5; Q96FR6; Q96L99; Q9UNS3
• Molecular Weight: 39.2 kDa
• NCBI Official Full Name: monocyte differentiation antigen CD14
• NCBI Official Synonym Full Names: CD14 molecule
• NCBI Official Symbol: CD14
• NCBI Protein Information: monocyte differentiation antigen CD14
• UniProt Protein Name: Monocyte differentiation antigen CD14
• Protein Family: Monocyte differentiation antigen
• UniProt Gene Name: CD14
• UniProt Entry Name: CD14_HUMAN

NCBI Description

The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Mar 2010]

Uniprot Description

CD14: Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: anchored to external side of plasma membrane; endosome membrane; extracellular region; extracellular space; Golgi apparatus; lipid raft; lipopolysaccharide receptor complex; plasma membrane

Molecular Function: lipopolysaccharide binding; opsonin receptor activity; peptidoglycan receptor activity; protein binding

Biological Process: apoptosis; cell surface receptor linked signal transduction; I-kappaB kinase/NF-kappaB cascade; inflammatory response; innate immune response; lipopolysaccharide-mediated signaling pathway; MyD88-dependent toll-like receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; phagocytosis; positive regulation of cytokine secretion; positive regulation of endocytosis; positive regulation of interferon type I production; positive regulation of interferon-gamma production; positive regulation of tumor necrosis factor production; programmed cell death; receptor-mediated endocytosis; response to electrical stimulus; response to ethanol; response to heat; response to magnesium ion; toll-like receptor 2 signaling pathway; toll-like receptor 3 signaling pathway; toll-like receptor 4 signaling pathway; toll-like receptor signaling pathway