Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

C-C motif chemokine 7 Recombinant Protein | CCL7 recombinant protein

Recombinant mouse C-C motif chemokine 7 protein

Gene Names
CCL7; FIC; MARC; MCP3; NC28; MCP-3; SCYA6; SCYA7
Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C motif chemokine 7; Recombinant mouse C-C motif chemokine 7 protein; Intercrine/chemokine MARC; Monocyte chemoattractant protein 3; Monocyte chemotactic protein 3; MCP-3; Protein FIC; Small-inducible cytokine A7; CCL7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Applicable Applications for CCL7 recombinant protein
SDS-PAGE, ELISA (EIA)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CCL7 recombinant protein
Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity By similarity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15 KD
NCBI Official Full Name
C-C motif chemokine 7
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 7
NCBI Official Symbol
CCL7
NCBI Official Synonym Symbols
FIC; MARC; MCP3; NC28; MCP-3; SCYA6; SCYA7
NCBI Protein Information
C-C motif chemokine 7; small-inducible cytokine A7; monocyte chemotactic protein 3; monocyte chemoattractant protein 3; small inducible cytokine A7 (monocyte chemotactic protein 3)
UniProt Protein Name
C-C motif chemokine 7
Protein Family
UniProt Gene Name
CCL7
UniProt Synonym Gene Names
MCP3; SCYA6; SCYA7; MCP-3
UniProt Entry Name
CCL7_HUMAN

NCBI Description

This gene encodes monocyte chemotactic protein 3, a secreted chemokine which attracts macrophages during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. The protein is an in vivo substrate of matrix metalloproteinase 2, an enzyme which degrades components of the extracellular matrix. This gene is part of a cluster of C-C chemokine family members on chromosome 17q. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.

Subunit structure: Monomer. Ref.8

Subcellular location: Secreted.

Post-translational modification: O-glycosylated.

Sequence similarities: Belongs to the intercrine beta (chemokine CC) family.

Sequence caution: The sequence CAA50405.1 differs from that shown. Reason: Erroneous initiation. The sequence CAA50406.1 differs from that shown. Reason: Erroneous initiation. The sequence CAA51055.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on CCL7

Similar Products

Product Notes

The CCL7 ccl7 (Catalog #AAA717338) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C-C motif chemokine 7 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA (EIA). Researchers should empirically determine the suitability of the CCL7 ccl7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PNASTCCYVK KQKIPKRNLK SYRRITSSRC PWEAVIFKTK KGMEVCAEAH QKWVEEAIAY LDMKTPTPKP. It is sometimes possible for the material contained within the vial of "C-C motif chemokine 7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.