C-C motif chemokine 7 Recombinant Protein | Ccl7 recombinant protein

Recombinant Mouse C-C motif chemokine 7

Cat. Num. AAA1265320

• Gene Names: Ccl7; fic; marc; mcp3; MCP-3; Scya7
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-C motif chemokine 7; Recombinant Mouse C-C motif chemokine 7; Intercrine/chemokine MAR; CMonocyte chemoattractant protein 3; Monocyte chemotactic protein 3; MCP-3; Protein FIC; Small-inducible cytokine A7; Ccl7 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 28-97aa; Partial
• Sequence: PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
• Sequence Length: 97

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Ccl7 recombinant protein

Chotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity.

References

Immunoglobulin E plus antigen challenge induces a novel intercrine/chemokine in mouse mast cells.Kulmburg P.A., Huber N.E., Scheer B.J., Wrann M., Baumruker T.J. Exp. Med. 176:1773-1778(1992) Mouse macrophage derived monocyte chemotactic protein-3 cDNA cloning and identification as MARC/FIC.Thirion S., Nys G., Fiten P., Masure S., van Damme J., Opdenakker G.Biochem. Biophys. Res. Commun. 201:493-499(1994) Werner F.The product of a novel growth factor-activated gene, fic, is a biologically active 'C-C'-type cytokine.Heinrich J.N., Ryseck R.P., Macdonald-Bravo H., Bravo R.Mol. Cell. Biol. 13:2020-2030(1993) A transcription factor with AP3-like binding specificity mediates gene regulation after an allergic triggering with IgE and Ag in mouse mast cells.Jarmin D.I., Kulmburg P.A., Huber N.E., Baumann G., Prieschl-Strassmayr E.E., Baumruker T.J. Immunol. 153:5720-5729(1994) Sequence polymorphisms in the chemokines Scya1 (TCA-3) , Scya2 (monocyte chemoattractant protein (MCP) -1) , and Scya12 (MCP-5) are candidates for eae7, a locus controlling susceptibility to monophasic remitting/nonrelapsing experimental allergic encephalomyelitis.Teuscher C., Butterfield R.J., Ma R.Z., Zachary J.F., Doerge R.W., Blankenhorn E.P.J. Immunol. 163:2262-2266(1999)

NCBI and Uniprot Product Information

• NCBI GI #: 7305463
• NCBI GeneID: 20306
• NCBI Accession #: NP_038682.1
• NCBI GenBank Nucleotide #: NM_013654.3
• UniProt Accession #: Q03366
• Molecular Weight: 12.1 kDa
• NCBI Official Full Name: C-C motif chemokine 7
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 7
• NCBI Official Symbol: Ccl7
• NCBI Official Synonym Symbols: fic; marc; mcp3; MCP-3; Scya7
• NCBI Protein Information: C-C motif chemokine 7
• UniProt Protein Name: C-C motif chemokine 7
• Protein Family: C-C motif chemokine
• UniProt Gene Name: Ccl7
• UniProt Synonym Gene Names: Fic; Mcp3; Scya7; MCP-3
• UniProt Entry Name: CCL7_MOUSE

Uniprot Description

CCL7: Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Cellular Component: extracellular region; extracellular space

Molecular Function: CCR2 chemokine receptor binding; chemokine activity; cytokine activity; heparin binding

Biological Process: chemotaxis; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response; lymphocyte chemotaxis; monocyte chemotaxis; neutrophil chemotaxis; positive regulation of GTPase activity; positive regulation of inflammatory response