C-C motif chemokine 3 Recombinant Protein | CCL3 recombinant protein

Recombinant Mouse C-C motif chemokine 3

Cat. Num. AAA717423

• Gene Names: Ccl3; Mip1a; Scya3; G0S19-1; AI323804; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-C motif chemokine 3; Recombinant Mouse C-C motif chemokine 3; Heparin-binding chemotaxis protein; L2G25B; Macrophage inflammatory protein 1-alpha; MIP-1-alpha; SIS-alpha; Small-inducible cytokine A3TY-5; CCL3 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 24-92aa; Full Length
• Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
• Sequence Length: 92

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CCL3 recombinant protein

Monokine with inflammatory, pyrogenic and chokinetic properties. Has a potent chotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils.

References

Cloning and characterization of a cDNA for murine macrophage inflammatory protein (MIP) , a novel monokine with inflammatory and chemokinetic properties.Davatelis G., Tekamp-Olson P., Wolpe S.D., Hermsen K., Luedke C., Gallegos C., Coit D., Merryweather J., Cerami A.J. Exp. Med. 167:1939-1944(1988) ErratumDavatelis G., Tekamp-Olson P., Wolpe S.D., Hermsen K., Luedke C., Gallegos C., Coit D., Merryweather J., Cerami A.J. Exp. Med. 170:2189-2189(1989) A family of small inducible proteins secreted by leukocytes are members of a new superfamily that includes leukocyte and fibroblast-derived inflammatory agents, growth factors, and indicators of various activation processes.Brown K.D., Zurawski S.M., Mosmann T.R., Zurawski G.J. Immunol. 142:679-687(1989) Sequence of the murine haemopoietic stem cell inhibitor/macrophage inflammatory protein 1 alpha gene.Grove M., Lowe S., Graham G., Pragnell I., Plumb M.Nucleic Acids Res. 18:5561-5561(1990) cDNA sequences of two inducible T-cell genes.Kwon B.S., Weissman S.M.Proc. Natl. Acad. Sci. U.S.A. 86:1963-1967(1989) Genomic structure of murine macrophage inflammatory protein-1 alpha and conservation of potential regulatory sequences with a human homolog, LD78.Widmer U., Yang Z., van Deventer S., Manogue K.R., Sherry B., Cerami A.J. Immunol. 146:4031-4040(1991) Sequence polymorphisms in the chemokines Scya1 (TCA-3) , Scya2 (monocyte chemoattractant protein (MCP) -1) , and Scya12 (MCP-5) are candidates for eae7, a locus controlling susceptibility to monophasic remitting/nonrelapsing experimental allergic encephalomyelitis.Teuscher C., Butterfield R.J., Ma R.Z., Zachary J.F., Doerge R.W., Blankenhorn E.P.J. Immunol. 163:2262-2266(1999) Macrophages secrete a novel heparin-binding protein with inflammatory and neutrophil chemokinetic properties.Wolpe S.D., Davatelis G., Sherry B., Beutler B., Hesse D.G., Nguyen H.T., Moldawer L.L., Nathan C.F., Lowry S.F., Cerami A.J. Exp. Med. 167:570-581(1988)

NCBI and Uniprot Product Information

• NCBI GI #: 6755432
• NCBI GeneID: 20302
• NCBI Accession #: NP_035467.1
• NCBI GenBank Nucleotide #: NM_011337.2
• UniProt Accession #: P10855; P14096
• Molecular Weight: 11.9 kDa
• NCBI Official Full Name: C-C motif chemokine 3
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 3
• NCBI Official Symbol: Ccl3
• NCBI Official Synonym Symbols: Mip1a; Scya3; G0S19-1; AI323804; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha
• NCBI Protein Information: C-C motif chemokine 3
• UniProt Protein Name: C-C motif chemokine 3
• Protein Family: C-C motif chemokine
• UniProt Gene Name: Ccl3
• UniProt Synonym Gene Names: Mip1a; Scya3; MIP-1-alpha
• UniProt Entry Name: CCL3_MOUSE

Uniprot Description

CCL3L1: Chemotactic for lymphocytes and monocytes. Is a ligand for CCR1, CCR3 and CCR5. Is an inhibitor of HIV-1-infection. The processed form LD78-beta(3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1- infection. LD78-beta(3-70) is also a ligand for CCR1, CCR3 and CCR5. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Chemokine; Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Cellular Component: extracellular region; extracellular space

Molecular Function: CCR chemokine receptor binding; chemokine activity; cytokine activity; protein binding

Biological Process: astrocyte cell migration; chemotaxis; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response; leukocyte chemotaxis; lymphocyte chemotaxis; macrophage chemotaxis; monocyte chemotaxis; neutrophil chemotaxis; positive regulation of GTPase activity; positive regulation of inflammatory response; positive regulation of interleukin-1 beta secretion; positive regulation of neuron apoptosis; positive regulation of osteoclast differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of tumor necrosis factor production; regulation of cell shape