Protein CCA1 (CCA1) Recombinant Protein | CCA1 recombinant protein
Recombinant Arabidopsis thaliana Protein CCA1 (CCA1) , partial
Gene Names
CCA1; AtCCA1; circadian clock associated 1; F19D11.11; MYB-RELATED DNA BINDING PROTEIN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein CCA1 (CCA1); Recombinant Arabidopsis thaliana Protein CCA1 (CCA1); partial; CCA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-316. Partial
Sequence
METNSSGEDLVIKTRKPYTITKQRERWTEEEHNRFIEALRLYGRAWQKIEEHVATKTAVQIRSHAQKFFSKVEKEAEAKGVAMGQALDIAIPPPRPKRKPNNPYPRKTGSGTILMSKTGVNDGKESLGSEKVSHPEMANEDRQQSKPEEKTLQEDNCSDCFTHQYLSAASSMNKSCIETSNASTFREFLPSREEGSQNNRVRKESNSDLNAKSLENGNEQGPQTYPMHIPVLVPLGSSITSSLSHPPSEPDSHPHTVAGDYQSFPNHIMSTLLQTPALYTAATFASSFWPPDSSGGSPVPGNSPPNLAAMAAATVA
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57,347 Da
NCBI Official Full Name
circadian clock associated 1
NCBI Official Symbol
CCA1
NCBI Official Synonym Symbols
AtCCA1; circadian clock associated 1; F19D11.11; MYB-RELATED DNA BINDING PROTEIN
NCBI Protein Information
circadian clock associated 1
UniProt Protein Name
Protein CCA1
Protein Family
UniProt Gene Name
CCA1
NCBI Description
Encodes a transcriptional repressor that performs overlapping functions with LHY in a regulatory feedback loop that is closely associated with the circadian oscillator of Arabidopsis. Binds to the evening element in the promoter of TOC1 and represses TOC1 transcription. CCA1 and LHY colocalize in the nucleus and form heterodimers in vivo. CCA1 and LHY function synergistically in regulating circadian rhythms of Arabidopsis.
Uniprot Description
Transcription factor involved in the circadian clock and in the phytochrome regulation. Binds to the promoter regions of APRR1/TOC1 and TCP21/CHE to repress their transcription. Binds to the promoter regions of CAB2A and CAB2B to promote their transcription. Represses both LHY and itself.
Research Articles on CCA1
Similar Products
Product Notes
The CCA1 cca1 (Catalog #AAA1190187) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-316. Partial. The amino acid sequence is listed below: METNSSGEDL VIKTRKPYTI TKQRERWTEE EHNRFIEALR LYGRAWQKIE EHVATKTAVQ IRSHAQKFFS KVEKEAEAKG VAMGQALDIA IPPPRPKRKP NNPYPRKTGS GTILMSKTGV NDGKESLGSE KVSHPEMANE DRQQSKPEEK TLQEDNCSDC FTHQYLSAAS SMNKSCIETS NASTFREFLP SREEGSQNNR VRKESNSDLN AKSLENGNEQ GPQTYPMHIP VLVPLGSSIT SSLSHPPSEP DSHPHTVAGD YQSFPNHIMS TLLQTPALYT AATFASSFWP PDSSGGSPVP GNSPPNLAAM AAATVA . It is sometimes possible for the material contained within the vial of "Protein CCA1 (CCA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
