Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Assembly factor CBP4 (CBP4) Recombinant Protein | PICST_55406 recombinant protein

Recombinant Scheffersomyces stipitis Assembly factor CBP4 (CBP4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Assembly factor CBP4 (CBP4); Recombinant Scheffersomyces stipitis Assembly factor CBP4 (CBP4); Recombinant Assembly factor CBP4 (CBP4); Assembly factor CBP4; Cytochrome b mRNA-processing protein 4; PICST_55406 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-147
Sequence
MSAKPLWYRWARVYFAGSCIIGTGVLCFIYTTPTDEQLIASFSPEIREDYEKNKAYRQREQQELMEIVKKTSQSDEPVWKTGPIGSPLEKEQRNLNQQLIDYNQFEKKRAEEYQREQIDKAQEELLEVEKLAAQAKKGYWWNPFSSK
Sequence Length
147
Species
Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,408 Da
NCBI Official Full Name
hypothetical protein PICST_55406
NCBI Official Symbol
PICST_55406
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Assembly factor CBP4
UniProt Gene Name
CBP4
UniProt Entry Name
CBP4_PICST

Uniprot Description

Function: Essential for the assembly of ubiquinol-cytochrome c reductase. It has a direct effect on the correct occurrence of the Rieske protein, core 4, core 5 and apocytochrome b

By similarity.

Subcellular location: Mitochondrion inner membrane; Single-pass membrane protein

By similarity.

Sequence similarities: Belongs to the CBP4 family.

Similar Products

Product Notes

The PICST_55406 cbp4 (Catalog #AAA1085302) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-147. The amino acid sequence is listed below: MSAKPLWYRW ARVYFAGSCI IGTGVLCFIY TTPTDEQLIA SFSPEIREDY EKNKAYRQRE QQELMEIVKK TSQSDEPVWK TGPIGSPLEK EQRNLNQQLI DYNQFEKKRA EEYQREQIDK AQEELLEVEK LAAQAKKGYW WNPFSSK. It is sometimes possible for the material contained within the vial of "Assembly factor CBP4 (CBP4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.