SDS-PAGE
Galactocerebrosidase (GALC) Recombinant Protein | GALC recombinant protein
Recombinant Human Galactocerebrosidase (GALC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Galactocerebrosidase (GALC); Recombinant Human Galactocerebrosidase (GALC); GALC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
43-685aa; Full-Length of the Mature Protein
Sequence
YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFLVEATR
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for GALC recombinant protein
This gene encodes a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
74.8 kDa
NCBI Official Full Name
galactocerebrosidase isoform a
NCBI Official Synonym Full Names
galactosylceramidase
NCBI Official Symbol
GALC
NCBI Protein Information
galactocerebrosidase
UniProt Protein Name
Galactocerebrosidase
Protein Family
UniProt Gene Name
GALC
UniProt Synonym Gene Names
GALCERase
NCBI Description
This gene encodes a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Uniprot Description
Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon.
Research Articles on GALC
Similar Products
Product Notes
The GALC galc (Catalog #AAA960920) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 43-685aa; Full-Length of the Mature Protein. The amino acid sequence is listed below: YVLDDSDGLG REFDGIGAVS GGGATSRLLV NYPEPYRSQI LDYLFKPNFG ASLHILKVEI GGDGQTTDGT EPSHMHYALD ENYFRGYEWW LMKEAKKRNP NITLIGLPWS FPGWLGKGFD WPYVNLQLTA YYVVTWIVGA KRYHDLDIDY IGIWNERSYN ANYIKILRKM LNYQGLQRVK IIASDNLWES ISASMLLDAE LFKVVDVIGA HYPGTHSAKD AKLTGKKLWS SEDFSTLNSD MGAGCWGRIL NQNYINGYMT STIAWNLVAS YYEQLPYGRC GLMTAQEPWS GHYVVESPVW VSAHTTQFTQ PGWYYLKTVG HLEKGGSYVA LTDGLGNLTI IIETMSHKHS KCIRPFLPYF NVSQQFATFV LKGSFSEIPE LQVWYTKLGK TSERFLFKQL DSLWLLDSDG SFTLSLHEDE LFTLTTLTTG RKGSYPLPPK SQPFPSTYKD DFNVDYPFFS EAPNFADQTG VFEYFTNIED PGEHHFTLRQ VLNQRPITWA ADASNTISII GDYNWTNLTI KCDVYIETPD TGGVFIAGRV NKGGILIRSA RGIFFWIFAN GSYRVTGDLA GWIIYALGRV EVTAKKWYTL TLTIKGHFAS GMLNDKSLWT DIPVNFPKNG WAAIGTHSFE FAQFDNFLVE ATR. It is sometimes possible for the material contained within the vial of "Galactocerebrosidase (GALC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
