Cobalt transport protein CbiM (cbiM) Recombinant Protein | RoseRS_0560 recombinant protein
Recombinant Roseiflexus sp. Cobalt transport protein CbiM (cbiM)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cobalt transport protein CbiM (cbiM); Recombinant Roseiflexus sp. Cobalt transport protein CbiM (cbiM); Recombinant Cobalt transport protein CbiM (cbiM); Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM; ECF transporter S component CbiM; RoseRS_0560 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-249
Sequence
MHIMEGFLPPVWAGFWFIVVLPFWVLGLRRINRLIAGKPETRLLLGFAAAFAFVLSALKIPSVTGSSSHPTGTGLGTILFGPLVMSVLGSIVLLFQALLIAHGGLTTLGANAFSMAVVGPFVAWLIWKGLKDRAPIWLTVFLAAALADLFTYVVTSAQLALAYPDAVGGFAASFARFGAIFAVTQIPLAISEGILTVLIFNALQANAQTELQSLGVLKGAQA
Sequence Length
249
Species
Roseiflexus sp. (strain RS-1)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,429 Da
NCBI Official Full Name
cobalamin biosynthesis protein CbiM
NCBI Official Symbol
RoseRS_0560
NCBI Protein Information
cobalamin biosynthesis protein CbiM
UniProt Protein Name
Cobalt transport protein CbiM
UniProt Gene Name
cbiM
UniProt Synonym Gene Names
ECF transporter S component CbiM
UniProt Entry Name
CBIM_ROSS1
Uniprot Description
Function: Part of the energy-coupling factor (ECF) transporter complex CbiMNOQ involved in cobalt import
By similarity. HAMAP-Rule MF_01462
Pathway: Cofactor biosynthesis; adenosylcobalamin biosynthesis. HAMAP-Rule MF_01462
Subunit structure: Forms an energy-coupling factor (ECF) transporter complex composed of an ATP-binding protein (A component, CbiO), a transmembrane protein (T component, CbiQ) and 2 possible substrate-capture proteins (S components, CbiM and CbiN) of unknown stoichimetry
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01462.
Sequence similarities: Belongs to the CbiM family.
Similar Products
Product Notes
The RoseRS_0560 cbim (Catalog #AAA1127584) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-249. The amino acid sequence is listed below: MHIMEGFLPP VWAGFWFIVV LPFWVLGLRR INRLIAGKPE TRLLLGFAAA FAFVLSALKI PSVTGSSSHP TGTGLGTILF GPLVMSVLGS IVLLFQALLI AHGGLTTLGA NAFSMAVVGP FVAWLIWKGL KDRAPIWLTV FLAAALADLF TYVVTSAQLA LAYPDAVGGF AASFARFGAI FAVTQIPLAI SEGILTVLIF NALQANAQTE LQSLGVLKGA QA. It is sometimes possible for the material contained within the vial of "Cobalt transport protein CbiM (cbiM), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
