Calcitonin gene-related peptide type 1 receptor (calcrl) Recombinant Protein | calcrl recombinant protein
Recombinant Xenopus tropicalis Calcitonin gene-related peptide type 1 receptor (calcrl)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcitonin gene-related peptide type 1 receptor (calcrl); Recombinant Xenopus tropicalis Calcitonin gene-related peptide type 1 receptor (calcrl); calcrl recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
29-472aa; full length protein
Sequence
EQEQGSQIPLEEIIQVGVTRNKIMTAQYECYQKIMQEPANGKEGHFCNRTWDGWLCWGDV SAGVISEQRCPDYFQDFDPSEKVTKECGKNGHWFRHPDSNRTWTNYTRCNTFTHEKVKTA LNLYYLTIIGHGLSIASLLISLGIFFYFKNLSCQRITLHKNLFFSFVCNSIITIISLSAV ANNQALVATNPVSCKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLL GWGFPLIPACIHAVARSLYYNDNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLIT KLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIAEEIYDYVMHILMHYQGL LVATIFCFFNGEVQAVLKRHWNQYKIQFGSSFAHSEGLRSASYTVSSISEIQGTTYTHDY SEQSNGKNCHDMENVFFKTEKQYM
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for calcrl recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54,404 Da
NCBI Official Full Name
calcitonin gene-related peptide type 1 receptor
NCBI Official Synonym Full Names
calcitonin receptor like receptor
NCBI Official Symbol
calcrl
NCBI Protein Information
calcitonin gene-related peptide type 1 receptor
UniProt Protein Name
Calcitonin gene-related peptide type 1 receptor
Protein Family
UniProt Gene Name
calcrl
UniProt Synonym Gene Names
CGRP type 1 receptor
UniProt Entry Name
CALRL_XENTR
Uniprot Description
Receptor for calcitonin-gene-related peptide (CGRP) (). Receptor specificity may be modulated by accessory proteins. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase ().
Similar Products
Product Notes
The calcrl calcrl (Catalog #AAA7010727) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-472aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the calcrl calcrl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EQEQGSQIPL EEIIQVGVTR NKIMTAQYEC YQKIMQEPAN GKEGHFCNRT WDGWLCWGDV SAGVISEQRC PDYFQDFDPS EKVTKECGKN GHWFRHPDSN RTWTNYTRCN TFTHEKVKTA LNLYYLTIIG HGLSIASLLI SLGIFFYFKN LSCQRITLHK NLFFSFVCNS IITIISLSAV ANNQALVATN PVSCKISQFI HLYLMGCNYF WMLCEGIYLH TLIVVAVFAE KQHLMWYYLL GWGFPLIPAC IHAVARSLYY NDNCWISSET HLLYIIHGPI CAALLVNLFF LLNIVRVLIT KLKVTHQAES NLYMKAVRAT LILVPLLGIE FVLFPWKPEG RIAEEIYDYV MHILMHYQGL LVATIFCFFN GEVQAVLKRH WNQYKIQFGS SFAHSEGLRS ASYTVSSISE IQGTTYTHDY SEQSNGKNCH DMENVFFKTE KQYM. It is sometimes possible for the material contained within the vial of "Calcitonin gene-related peptide type 1 receptor (calcrl), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
