Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Voltage-dependent calcium channel gamma-8 subunit (CACNG8) Recombinant Protein | CACNG8 recombinant protein

Recombinant Human Voltage-dependent calcium channel gamma-8 subunit (CACNG8)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Voltage-dependent calcium channel gamma-8 subunit (CACNG8); Recombinant Human Voltage-dependent calcium channel gamma-8 subunit (CACNG8); CACNG8 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-425aa; full length protein
Sequence
MESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAG GDDGTPHRGGGGASEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEY LLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVY ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRS DLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRSSEPSPSRDASPGGPGGPGFA STDISMYTLSRDPSKGSVAAGLAGAGGGGGGAVGAFGGAAGGAGGGGGGGGGAGAERDRG GASGFLTLHNAFPKEAGGGVTVTVTGPPAPPAPAPPAPSAPAPGTLAKEAAASNTNTLNR KTTPV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CACNG8 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,313 Da
NCBI Official Full Name
voltage-dependent calcium channel gamma-8 subunit
NCBI Official Synonym Full Names
calcium voltage-gated channel auxiliary subunit gamma 8
NCBI Official Symbol
CACNG8
NCBI Protein Information
voltage-dependent calcium channel gamma-8 subunit
UniProt Protein Name
Voltage-dependent calcium channel gamma-8 subunit
UniProt Gene Name
CACNG8
UniProt Synonym Gene Names
CACNG6; TARP gamma-8
UniProt Entry Name
CCG8_HUMAN

NCBI Description

The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type II TARP and a calcium channel gamma subunit. The mRNA for this gene is believed to initiate translation from a non-AUG (CUG) start codon. [provided by RefSeq, Dec 2010]

Uniprot Description

CACNG8: Regulates the trafficking and gating properties of AMPA- selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state. Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.

Protein type: Membrane protein, multi-pass; Channel, calcium; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: cell junction; plasma membrane; postsynaptic density; postsynaptic membrane; voltage-gated calcium channel complex

Molecular Function: channel regulator activity; voltage-gated calcium channel activity

Biological Process: calcium ion transport; transmission of nerve impulse

Similar Products

Product Notes

The CACNG8 cacng8 (Catalog #AAA7010703) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-425aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CACNG8 cacng8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MESLKRWNEE RGLWCEKGVQ VLLTTVGAFA AFGLMTIAIS TDYWLYTRAL ICNTTNLTAG GDDGTPHRGG GGASEKKDPG GLTHSGLWRI CCLEGLKRGV CVKINHFPED TDYDHDSAEY LLRVVRASSI FPILSAILLL LGGVCVAASR VYKSKRNIIL GAGILFVAAG LSNIIGVIVY ISANAGEPGP KRDEEKKNHY SYGWSFYFGG LSFILAEVIG VLAVNIYIER SREAHCQSRS DLLKAGGGAG GSGGSGPSAI LRLPSYRFRY RRRSRSSSRS SEPSPSRDAS PGGPGGPGFA STDISMYTLS RDPSKGSVAA GLAGAGGGGG GAVGAFGGAA GGAGGGGGGG GGAGAERDRG GASGFLTLHN AFPKEAGGGV TVTVTGPPAP PAPAPPAPSA PAPGTLAKEA AASNTNTLNR KTTPV. It is sometimes possible for the material contained within the vial of "Voltage-dependent calcium channel gamma-8 subunit (CACNG8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.