Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ITGA3Sample Tissue: Human ACHNWhole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ITGA3 Polyclonal Antibody | anti-ITGA3 antibody

ITGA3 Antibody - middle region

Gene Names
ITGA3; VL3A; CD49C; FRP-2; GAPB3; ILNEB; MSK18; VCA-2; VLA3a; GAP-B3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ITGA3; Polyclonal Antibody; ITGA3 Antibody - middle region; anti-ITGA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEAD
Sequence Length
1051
Applicable Applications for anti-ITGA3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ITGA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ITGA3Sample Tissue: Human ACHNWhole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ITGA3Sample Tissue: Human ACHNWhole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ITGA3 antibody
The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 3 subunit. This subunit joins with a beta 1 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. Expression of this gene may be correlated with breast cancer metastasis.
Product Categories/Family for anti-ITGA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
117 kDa
NCBI Official Full Name
integrin alpha-3 preproprotein
NCBI Official Synonym Full Names
integrin subunit alpha 3
NCBI Official Symbol
ITGA3
NCBI Official Synonym Symbols
VL3A; CD49C; FRP-2; GAPB3; ILNEB; MSK18; VCA-2; VLA3a; GAP-B3
NCBI Protein Information
integrin alpha-3
UniProt Protein Name
Integrin alpha-3
Protein Family
UniProt Gene Name
ITGA3
UniProt Synonym Gene Names
MSK18; GAPB3
UniProt Entry Name
ITA3_HUMAN

NCBI Description

The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 3 subunit. This subunit joins with a beta 1 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. Expression of this gene may be correlated with breast cancer metastasis. [provided by RefSeq, Oct 2015]

Uniprot Description

ITGA3: an integral membrane protein that heterodimerizes with a beta chain, forming a receptor for many extracellular-matrix proteins including fibronectin, laminin, collagen, epiligrin and thrombospondin. Undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1. Two alternatively spliced isoforms have been described.

Protein type: Cell adhesion; Receptor, misc.; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q21.33

Cellular Component: filopodium membrane; focal adhesion; cell surface; growth cone; basolateral plasma membrane; perinuclear region of cytoplasm; plasma membrane; excitatory synapse; integrin complex; receptor complex; external side of plasma membrane

Molecular Function: integrin binding; collagen binding; protein domain specific binding; protein binding; protease binding; protein heterodimerization activity; fibronectin binding; metal ion binding; laminin binding; glycoprotein binding

Biological Process: skin development; response to drug; integrin-mediated signaling pathway; extracellular matrix organization and biogenesis; maternal process involved in pregnancy; cell-matrix adhesion; heart development; regulation of BMP signaling pathway; regulation of Wnt receptor signaling pathway; neuron migration; mesodermal cell differentiation; memory; regulation of transforming growth factor beta receptor signaling pathway; negative regulation of Rho protein signal transduction; blood coagulation; leukocyte migration; negative regulation of cell projection organization and biogenesis; lung development

Disease: Interstitial Lung Disease, Nephrotic Syndrome, And Epidermolysis Bullosa, Congenital

Research Articles on ITGA3

Similar Products

Product Notes

The ITGA3 itga3 (Catalog #AAA3220876) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGA3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITGA3 itga3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLVPRPAVLD PALCTATSCV QVELCFAYNQ SAGNPNYRRN ITLAYTLEAD. It is sometimes possible for the material contained within the vial of "ITGA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.