Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Voltage-dependent calcium channel subunit alpha-2/delta-1 Recombinant Protein | CACNA2D1 recombinant protein

Recombinant Human Voltage-dependent calcium channel subunit alpha-2/delta-1

Gene Names
CACNA2D1; CACNA2; CCHL2A; CACNL2A; LINC01112; lncRNA-N3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Voltage-dependent calcium channel subunit alpha-2/delta-1; Recombinant Human Voltage-dependent calcium channel subunit alpha-2/delta-1; Voltage-gated calcium channel subunit alpha-2/delta-1; CACNA2D1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
528-668. Partial
Sequence
QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN
Sequence Length
1091
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for CACNA2D1 recombinant protein
The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling.
Product Categories/Family for CACNA2D1 recombinant protein
References
Structure and functional expression of alpha 1, alpha 2, and beta subunits of a novel human neuronal calcium channel subtype.Williams M.E., Feldman D.H., McCue A.F., Brenner R., Velicelebi G., Ellis S.B., Harpold M.M.Neuron 8:71-84(1992)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
781
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.3 kDa
NCBI Official Full Name
voltage-dependent calcium channel subunit alpha-2/delta-1 preproprotein
NCBI Official Synonym Full Names
calcium voltage-gated channel auxiliary subunit alpha2delta 1
NCBI Official Symbol
CACNA2D1
NCBI Official Synonym Symbols
CACNA2; CCHL2A; CACNL2A; LINC01112; lncRNA-N3
NCBI Protein Information
voltage-dependent calcium channel subunit alpha-2/delta-1
UniProt Protein Name
Voltage-dependent calcium channel subunit alpha-2/delta-1
UniProt Gene Name
CACNA2D1
UniProt Synonym Gene Names
CACNL2A; CCHL2A; MHS3
UniProt Entry Name
CA2D1_HUMAN

NCBI Description

The preproprotein encoded by this gene is cleaved into multiple chains that comprise the alpha-2 and delta subunits of the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. Mutations in this gene can cause cardiac deficiencies, including Brugada syndrome and short QT syndrome. Alternate splicing results in multiple transcript variants, some of which may lack the delta subunit portion. [provided by RefSeq, Nov 2014]

Uniprot Description

CACNA2D1: The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling. Belongs to the calcium channel subunit alpha-2/delta family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, calcium

Chromosomal Location of Human Ortholog: 7q21-q22

Cellular Component: plasma membrane; sarcoplasmic reticulum; voltage-gated calcium channel complex

Molecular Function: metal ion binding; voltage-gated calcium channel activity

Biological Process: calcium ion transport; regulation of calcium ion transport

Research Articles on CACNA2D1

Similar Products

Product Notes

The CACNA2D1 cacna2d1 (Catalog #AAA959628) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 528-668. Partial. The amino acid sequence is listed below: QPKPIGVGIP TINLRKRRPN IQNPKSQEPV TLDFLDAELE NDIKVEIRNK MIDGESGEKT FRTLVKSQDE RYIDKGNRTY TWTPVNGTDY SLALVLPTYS FYYIKAKLEE TITQARYSET LKPDNFEESG YTFIAPRDYC N. It is sometimes possible for the material contained within the vial of "Voltage-dependent calcium channel subunit alpha-2/delta-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.