C4b-binding protein alpha chain (C4bpa) Recombinant Protein | C4bpa recombinant protein
Recombinant Rat C4b-binding protein alpha chain (C4bpa)
Gene Names
C4bpa; C4BP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C4b-binding protein alpha chain (C4bpa); Recombinant Rat C4b-binding protein alpha chain (C4bpa); C4bpa recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
14-558, full length protein
Sequence
KCGPPPDLPYALPASEMNQTDFESHTTLRYNCRPGYSRASSSQSLYCKPLGKWQINIACVKKSCRNPGDLQNGKVEVKTDFLFGSQIEFSCSEGYILIGSSTSYCEIQGKGVSWSDPLPECVIAKCGMPPDISNGKHNGREEEFFTYRSSVTYKCDPDFTLLGNASITCTVVNKTVGVWSPSPPTCERIICPWPKVLHGTINSGFKHTYKYKDSVRFVCQKGFVLRGSGVIHCEADGSWSPVPVCELNSCTDIPDIPNAALITSPRPRKEDVYPVGTVLRYICRPGYEPATRQPMTVICQKDLSWSMLRGCKEICCPVPDPKSVRVIQHEKAHPDNDCTYFFGDEVSYTCQNDIMLTATCKSDGTWHPRTPSCHQSCDFPPAIAHGRYTKSSSYYVRTQVTYECEEGYRLVGEATISCWYSQWTPAAPQCKALCRKPEIGNGVLSTNKDQYVETENVTIQCDSGFVMLGSQSITCSENGTWYPKVSRCEQEVPKDCEHVFAGKKLMQCLPNSNDVKMALEVYKLTLEIKQLQLQIDKAKHVDREL
Sequence Length
545
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for C4bpa recombinant protein
This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
62,266 Da
NCBI Official Full Name
C4b-binding protein alpha chain
NCBI Official Synonym Full Names
complement component 4 binding protein, alpha
NCBI Official Symbol
C4bpa
NCBI Official Synonym Symbols
C4BP
NCBI Protein Information
C4b-binding protein alpha chain
UniProt Protein Name
C4b-binding protein alpha chain
Protein Family
UniProt Gene Name
C4bpa
UniProt Synonym Gene Names
C4bp
NCBI Description
regulatory protein for the complement system of the innate immune response [RGD, Feb 2006]
Uniprot Description
Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component.
Research Articles on C4bpa
Similar Products
Product Notes
The C4bpa c4bpa (Catalog #AAA1375944) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 14-558, full length protein. The amino acid sequence is listed below: KCGPPPDLPY ALPASEMNQT DFESHTTLRY NCRPGYSRAS SSQSLYCKPL GKWQINIACV KKSCRNPGDL QNGKVEVKTD FLFGSQIEFS CSEGYILIGS STSYCEIQGK GVSWSDPLPE CVIAKCGMPP DISNGKHNGR EEEFFTYRSS VTYKCDPDFT LLGNASITCT VVNKTVGVWS PSPPTCERII CPWPKVLHGT INSGFKHTYK YKDSVRFVCQ KGFVLRGSGV IHCEADGSWS PVPVCELNSC TDIPDIPNAA LITSPRPRKE DVYPVGTVLR YICRPGYEPA TRQPMTVICQ KDLSWSMLRG CKEICCPVPD PKSVRVIQHE KAHPDNDCTY FFGDEVSYTC QNDIMLTATC KSDGTWHPRT PSCHQSCDFP PAIAHGRYTK SSSYYVRTQV TYECEEGYRL VGEATISCWY SQWTPAAPQC KALCRKPEIG NGVLSTNKDQ YVETENVTIQ CDSGFVMLGS QSITCSENGT WYPKVSRCEQ EVPKDCEHVF AGKKLMQCLP NSNDVKMALE VYKLTLEIKQ LQLQIDKAKH VDREL. It is sometimes possible for the material contained within the vial of "C4b-binding protein alpha chain (C4bpa), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
