C3a anaphylatoxin chemotactic receptor (C3ar1) Recombinant Protein | C3ar1 recombinant protein
Recombinant Mouse C3a anaphylatoxin chemotactic receptor (C3ar1)
Gene Names
C3ar1; AZ3B; C3AR; HNFAG09
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C3a anaphylatoxin chemotactic receptor (C3ar1); Recombinant Mouse C3a anaphylatoxin chemotactic receptor (C3ar1); C3ar1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-477aa; Full length protein
Sequence
MESFDADTNSTDLHSRPLFQPQDIASMVILGLTCLLGLLGNGLVLWVAGVKMKTTVNTVW FLHLTLADFLCCLSLPFSLAHLILQGHWPYGLFLCKLIPSIIILNMFASVFLLTAISLDR CLIVHKPIWCQNHRNVRTAFAICGCVWVVAFVMCVPVFVYRDLFIMDNRSICRYNFDSSR SYDYWDYVYKLSLPESNSTDNSTAQLTGHMNDRSAPSSVQARDYFWTVTTALQSQPFLTS PEDSFSLDSANQQPHYGGKPPNVLTAAVPSGFPVEDRKSNTLNADAFLSAHTELFPTASS GHLYPYDFQGDYVDQFTYDNHVPTPLMAITITRLVVGFLVPFFIMVICYSLIVFRMRKTN FTKSRNKTFRVAVAVVTVFFICWTPYHLVGVLLLITDPESSLGEAVMSWDHMSIALASAN SCFNPFLYALLGKDFRKKARQSIKGILEAAFSEELTHSTNCTQDKASSKRNNMSTDV
Sequence Length
477
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for C3ar1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53,576 Da
NCBI Official Full Name
C3a anaphylatoxin chemotactic receptor
NCBI Official Synonym Full Names
complement component 3a receptor 1
NCBI Official Symbol
C3ar1
NCBI Official Synonym Symbols
AZ3B; C3AR; HNFAG09
NCBI Protein Information
C3a anaphylatoxin chemotactic receptor
UniProt Protein Name
C3a anaphylatoxin chemotactic receptor
Protein Family
UniProt Gene Name
C3ar1
UniProt Synonym Gene Names
C3r1; C3AR; C3a-R
UniProt Entry Name
C3AR_MOUSE
Uniprot Description
C3aR: Receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production. Belongs to the G-protein coupled receptor 1 family.
Protein type: GPCR, family 1; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass
Cellular Component: cytosol; integral to membrane; membrane; plasma membrane
Molecular Function: anaphylatoxin receptor activity; C3a anaphylatoxin receptor activity; complement component C3a binding; G-protein coupled receptor activity; signal transducer activity
Biological Process: chemotaxis; complement receptor mediated signaling pathway; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; positive regulation of angiogenesis; positive regulation of cell migration; positive regulation of smooth muscle cell proliferation; regulation of blood pressure; signal transduction; tolerance induction to nonself antigen
Research Articles on C3ar1
Similar Products
Product Notes
The C3ar1 c3ar1 (Catalog #AAA7010564) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-477aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the C3ar1 c3ar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MESFDADTNS TDLHSRPLFQ PQDIASMVIL GLTCLLGLLG NGLVLWVAGV KMKTTVNTVW FLHLTLADFL CCLSLPFSLA HLILQGHWPY GLFLCKLIPS IIILNMFASV FLLTAISLDR CLIVHKPIWC QNHRNVRTAF AICGCVWVVA FVMCVPVFVY RDLFIMDNRS ICRYNFDSSR SYDYWDYVYK LSLPESNSTD NSTAQLTGHM NDRSAPSSVQ ARDYFWTVTT ALQSQPFLTS PEDSFSLDSA NQQPHYGGKP PNVLTAAVPS GFPVEDRKSN TLNADAFLSA HTELFPTASS GHLYPYDFQG DYVDQFTYDN HVPTPLMAIT ITRLVVGFLV PFFIMVICYS LIVFRMRKTN FTKSRNKTFR VAVAVVTVFF ICWTPYHLVG VLLLITDPES SLGEAVMSWD HMSIALASAN SCFNPFLYAL LGKDFRKKAR QSIKGILEAA FSEELTHSTN CTQDKASSKR NNMSTDV. It is sometimes possible for the material contained within the vial of "C3a anaphylatoxin chemotactic receptor (C3ar1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
